Welcome to TradeChina
-
RELATED CATEGORIES:
Refrigerated Combo Snack Drink Vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Machinery Refrigeration and Heat Exchange Hot Fresh Food Bento/ Lunch Vending Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Automatic Snack And Drink Combo Vending Machine Cold Drink
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Free Standing Coffee Vending Machine with CE Certification/Cup Dispenser/Bill Validator/Coin Acceptor
$ -
>=2 Unit
Meo Advertising Co.LTD
Hot and cold coffee drink vending machine
$ 325 ~ $ 370
>=1 Unit
Meo Textile Clothing Co.LTD
LV-X01 snack cold drink and coffee vending machine
$ -
>=7 Unit
Meo Textile Clothing Co.LTD
egg vending machine with cooling system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
XY Freezer cold drink 24H coin operated vending machine for beer
$ -
>=30 Set
Meo Textile Clothing Co.LTD
ZG Cb Automatic Good Quality 24 Shop Snack And Cold Drink Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Touch screen vending machine for cold drinks
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Self-service cold drinks smart vending machines with Coin mechanism & note acceptor
$ -
>=1 Set
Meo Textile Clothing Co.LTD
concentrate orange juice/orange juicer vending machine/commercial orange juicer machine WF1-G32
$ 290 ~ $ 400
>=1 piec
Meo Textile Clothing Co.LTD
Standing Commercial Smart Fresh Ground Coffee Vending Machine With Cloud Management
$ -
>=2 Set
Meo Textile Clothing Co.LTD
outdoor coffee vending machine
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Afen AF-60 large capacity automatic cola bottled canned hot cold drink vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN sweet tea snack coffee vending machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Perfumes cosmetics women use mini mart vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
quality automatic fresh fruit snack cold vending machines sanitary napkin orange juice ice drink fruit cotton candy
$ 999
>=1 Set
Meo Textile Clothing Co.LTD
Prompt facility Our ex-works price vending machine/milk tea vending machine commercial coffee vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Cold drinks cup noodle condom durex vending machine with bill coin card reader payment and remote management platform
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
snack drinks smart cold drink vending machines in Nursing Homes
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Food Drink Lockers Vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic Beverage Vending Cold Drink Vending Machine
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Drinks and snack water coffee let's pizza vending machine/self vending machine for cold drinks water
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheese/Cold Desserts/ Vending Fridge
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Hot Cold Coffee Tea Commercial Koisk OCS Qr Pay Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
GS505 Touch Screen Operate Protein Shakes Cold Energy Drink Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Economical model lower price&high quality cold drink bottled&snak Vending Machine with factory price and CE Approval
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
ZG Ce Cb White Cold Drink Snack And Drink Vendor Touchscreen Vending Machine With Touch Screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Top seller big combo vending machines for snack and cold drinks
$ -
>=1 piec
Meo Textile Clothing Co.LTD
XY Bottled Water Beer Cold Drink Auto Snack Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Comercial Coffee Vending Machine Fully Automatic Instant Coffee Drink Desktop Coffee Maker with 4 Flavor
$ 225 ~ $ 280
>=1 Set
Meo Textile Clothing Co.LTD
Simulated Manual Grind coffee vending machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
12-Selection touch screen coin Operated Instant Coffee Vending Machine WF1-606A
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Shop 24 self-service cake meat milk salad sandwich coconut beer drink pharmacy refrigerator vending machine with conveyor belt
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN new and hot products hot & cold drink vending machine with CE CB ISO9001
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Customized 21.5inch advertising screen drink snack vending combo vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN New model Popular Automatic Snack Drink Vending Machine with 32 inches screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot drinks 1600W, the most sought-after style vending machine/tea coffee vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
ZIMA self-help drinks snack touch screen cold drink vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Hot product Snack and Drink Vending Machine for sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Drinks Combo Wifi Vending Beverage Machine Price
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Cheese/Cold Desserts/ Vending Lockers
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Automatic vending machine from China yinong factory GS505 maquinas expendedora bebidas
$ -
>=1 piec
Meo Textile Clothing Co.LTD
hot food vending machine LE201A
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
High capacity automatic drink beverage vending machine with refrigeration
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Retail Snack Automatic Distributors Of Drinks Snacks Food Grade Commercial Snack/beverage And Cold Drink Vending Machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
2018 hot product high capacity automatic cold drink coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot beverage vending machine with heating and cooling system
$ -
>=1 piec
Meo Textile Clothing Co.LTD
24 hour self service snack vending machine with card reader for food pizza
$ -
>=2 piec
Meo Textile Clothing Co.LTD
Related Searches:
gumvendingmachinecarddispensermachinewatervendingvendingstorefrozenvendingmachineeyelashvendingmachinesodavendingmachinebusinesscoinoperatedcandydispensercafecoffeedayvendingmachinepriceantiquecocacolamachinenescafecoffeevendingmachinepricesimcardvendingmachinecakevendingmachineexpendingmachineskittlesvendingmachineforsalesodamachinecostcashlessvendingmachinesnewandusedvendingmachinesusedcokemachinevendomachineforsalefooddispensermachinehotmealvendingmachineusedcombovendingmachinessoftdrinkmachinepricetopvendingmachinecompanies1950scokemachinepizzafornovendingmachinegiftcardvendingmachinevendingcoffeebusinesseslookingforvendingmachines