Welcome to TradeChina
-
RELATED CATEGORIES:
Coffee Hot Chocolate Protein Shake Vending Machine with Free Spare Parts
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Smart Cold Drink Protein Shake Vending Machine Kiosk Touch Screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Best Selling Coffee Protein Shake Drink Vending Machine for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Self-service Machine Coffee Bean Grinder Vending Machine for Outdoor Public Use
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Coin and Note Operated Instant Coffee Protein Shake Vending Machine Payment Kiosk
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Commercial cheap drink vending machine yinong factory
$ 650 ~ $ 720
>=1 Unit
Meo Textile Clothing Co.LTD
Combined Type Vending Machine for Combo Snack and Drink
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Snack vending car mobile burger food trailer truck fresh coconut cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2019 factory new design outdoor ice cream cart coconut shape kiosk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Air Water Dispenser/ Atmospheric water generator 50L good price
$ 700
>=1 Set
Meo Advertising Co.LTD
RO Drinking Shopping Mall Public Water Dispenser
$ 550 ~ $ 600
>=1 Unit
Meo Advertising Co.LTD
Electric 3 wheels summer ice cream cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Good quality with 4 tanks commercial juicer dispenser
$ 414 ~ $ 506
>=1 Set
Meo Textile Clothing Co.LTD
Hot & cold coffee chocolate hot cold water dispenser beverage dispenser milka chocolate Nestle drink vending machine
$ 520 ~ $ 780
>=50 Piece
Meo Textile Clothing Co.LTD
Big capacity beverage vending machine with low price XY-DLE-10B
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Food Industry Specifically Designs commercial daiquiri machine Cooling Tunnel Machine
$ -
>=1 Meter
Meo Textile Clothing Co.LTD
Related Searches:
toycapsulemachinecandymachinetoyvendomachineforsaledonutvendingmachineatlantiscoffeevendingmachinesodavendingmachinebusinessicecreamvendingmachineforsalevendingsupplycontactlessvendingmachineforsaleusedsodavendingmachinesforsalenearmeicevendingmachinebusinessforsalevendingstorecoffeevendomachineforsalegiftcardvendingmachinecappuccinovendingmachineeyelashvendingmachineskittlesvendingmachineforsalesilentsalesforcegumballmachineantaresvendingmachinemilkvendingmachinepriceexpendingmachinelaysvendingmachinebubblegumvendingmachinevendingmachineplacementcommercialvendingmachinepepsimachinesgumvendingmachinevendingshopcoffeepremixforvendingmachinenestlecoffeevendingmachine