Welcome to TradeChina
-
RELATED CATEGORIES:
Germany high quality vending machine kiosk with bill payment
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Self service bubble tea vending machine with cooling system ,Bottled water beer cold drink auto snack vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Guangdong Guangzhou Gum Ball Gumball Extension Hamburger Hair Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
cold drinks 1000w The most popular vending machine/milky tea vending machine automatic milk vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic Food Beverage Drink Vending Machine for Sales
$ 750
>=1 Piece
Meo Textile Clothing Co.LTD
self service cold can and bottles drink vending machine with touch screen
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Iced Tea & Coffee Vending Machine
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
RFID Automatic Vending Freezer For Frozen Food
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Automatic Cold Drink Beverage Product Vending Machine
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
HOT Sale Commercial Coffee Vending Machine with 4 Flavor Hot and Cold Drinks
$ 650 ~ $ 720
>=1 Set
Meo Textile Clothing Co.LTD
Best-selling Snacks And Drinks,Combo Spiral Vending Machine
$ -
>=10 piec
Meo Textile Clothing Co.LTD
Multi-functional 24 hours Vending Machine For Cold Drink Beverage and Snack
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Best seller combo snack and cold drinks vending machine with 60 slots
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Master and Slave vending machine with refrigerator,bill and coin accepter, credit card reader.
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Zoomgu hot sale combo cold drink and coffee vending machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Automatic snacks bottled water beer cold drinks smart vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Beverage Snack Drink vending machine WD1-201A
$ -
>=1 piec
Meo Textile Clothing Co.LTD
AFEN myr currency ecuador 19inch cold hot drink coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Auto Clean Coffee Automatic Protein Shake Vending Machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Fresh brew Coffee Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
TCN Cold Drink Protein Vending Machines Dispenser Video Technical Support Free Spare Parts 1 YEAR Online Support
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Glass bottle drinks mini mart vending kiosk with advertising function big touch screen remote control
$ -
>=1 Set
Meo Textile Clothing Co.LTD
automatic payment 24 hours smart mini mart sweet hot dog sandwich soda can vending machine for food drinks
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Cheap price high quality cold drink vending machine beverage snack vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
A heavy fragrance vending machine/tea coffee vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
2020 Hot sale kitchen appliance made in china coffee machine
$ 360
>=50 piec
Meo Textile Clothing Co.LTD
Vending machine coffee/coin cold powder drinks and snacks combination vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
App payment able to send promotion coupon black vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Refrigerated Combo Snack&Drink Vending Machine with Lift/Elevator
$ -
>=2 Piece
Meo Textile Clothing Co.LTD
Vegetables Fresh Seafood Cold Food Salad/Fruits Vending Fridge Machine
$ 850
>=10 Piece
Meo Textile Clothing Co.LTD
Dispenser Beverage Drinks Combo Vending Machine With 32 Inch Lcd Display Vending Machine For Small Product
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Hot&Cold Instant Drink Vending Machine with 27 inch Touch Panel
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Protein Shakes Vending Machine Gym Sports Center Drink Self-vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Good quality Snack and coffee vending machine LE209A
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Combo snack drinks vending machine with lifetime free maintenance service
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Self service cup noodles ramen vending machine with hot and cold water
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Hunan Zoomgu automatic snack cola vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic vending machine for snacks cold drinks with lifetime free maintenance service
$ -
>=1 piec
Meo Textile Clothing Co.LTD
2019 Best Selling Snack and Cold Beverage hotel vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Combo Cold Snack cheap vending machine Auto Vending Machine WD1-205A
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Automatically Coffee Vending Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
YN Hot and Drink Protein Shake Vending Machine with Automatic cleaning
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Afen factory snack bottled water beer cold drink auto affordable vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN Cold water vending machine mashin mrp coke vending machines for sale near me
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Belt Conveyor healthy drink food Combo Elevator small Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
robot arm cheap tobacco toy capsule wine self vending machine for hair weave business 2021
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot drinks 1600W, attractive in price and quality vending machine/coffee dispenser machine/cheap vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic Smart unnmaned automatic no touch condom durex vending machine for food and drinks and clothing
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
mini vending machine/buy japanese vending machine /small vending machine for drinks and snack
$ -
>=1 Set
Meo Textile Clothing Co.LTD
digital intelligent cold brew coffee automatic drink vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Related Searches:
meivendingmachinelypcgumballmachineantiquecocacolamachinelavazzavendingbeervendingmachineforsalecontactlessvendingmachineforsalecandyvendingmachinebusinessantaresvendingmachineoldpepsivendingmachineusedcombovendingmachinesnorthwesternvendingmachinesnescafecoffeevendingmachinepriceusedsodavendingmachinesforsalenearmedonutvendingmachinecoldfoodvendingmachinesdrinkvendingmachinenearmecappuccinovendingmachinesodavendingmachinebusinesssmartvendingsolutionscoffeedaymachinecosticevendingmachinebusinessforsalequartercandymachineeyelashvendingmachinetopvendingmachinecompanieshotvendingmachinesrunningavendingmachinebusinesssoftdrinkmachinepriceicecreamvendingmachineforsalevendingsystemfrozenfoodvendingmachines