Welcome to TradeChina
-
RELATED CATEGORIES:
- Baby Children & Maternity
- Building Materials
- Electronics & Appliances
- Food
- Furniture & Decoration
- Homelife
- Industrial Machinery
- Material Handling
- Commercial Equipment & Machinery
- Compressors, Refrigeration & Heating Equipment
- Fasteners & Processing Equipment
- Food & Beverage Machinery
- Home Goods & Chemical Product Manufacturing Machinery
- Logistics Technology & Transportation Systems
- Machine Tools & Metalworking
- Power Transmission
- Packaging & Printing
- Metals & Alloys
- Vehicles & Transportation
- New Energy
- Textiles & Garments
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare Parts
$ 90
>=10 piec
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Top Bulk Gumball/Candy Vending Machine cv18r
$ 27 ~ $ 29
>=20 Piece
Meo Textile Clothing Co.LTD
smart touch screen mini small mask coffee snack water vending machine automatic for sale
$ 200
>=500 Set
Meo Textile Clothing Co.LTD
TCN Hot /cold Water/hot Drinks Instant Powder Coffee Vending Machine With Lcd Advertisement
$ -
>=2 Set
Meo Textile Clothing Co.LTD
outdoor commercial automatic touch screen coin operated table top machines bean to cup hot coffee instant vending machine price
$ 340 ~ $ 350
>=2 Unit
Meo Textile Clothing Co.LTD
Oem/odm Fully Automatic Whole Bean Dispenser Self Coffee Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
outdoor vending machine combo wifi smart touch screen vending machine/medical vending machine/vending machine coffee
$ 888.88
>=1 Piece
Meo Textile Clothing Co.LTD
For Singapore market Iced Espresso Coffee QR code Vending Machine LE308F
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Touch Screen for Automatic Coin Instant Coffee and Tea Iced Coffee Vending Machine with WIFI and 4G
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Smart Coffee Vending Machine With Ice Maker
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Best selling full automatic vending coffee ,hot cold coffee vending machine ,coffee machine vending
$ 380 ~ $ 500
>=1 vending
Meo Textile Clothing Co.LTD
Bangladesh commercial instant vending coffee making machineMQ-003
$ 220 ~ $ 250
>=1 Set
Meo Textile Clothing Co.LTD
outdoor vending machine combo wifi smart touch screen vending machine/medical vending machine/vending machine coffee
$ 888.88
>=1 Piece
Meo Textile Clothing Co.LTD
Fully Automatic vending Machine to Sale Coffee with Cash Payment
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Vending machine coffee
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Freshly Brewed coffee vending
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
AFEN automatic easily used coffee vending machine with cup dispenser for shopping street
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN big coffee and hot drinks vending machine a cafe vending machine
$ -
>=3 Set
Meo Textile Clothing Co.LTD
Hotel Automatic Self Service Vending Machine Selling Coffee, Condoms
$ 456 ~ $ 554
>=1 Piece
Meo Textile Clothing Co.LTD
cup noodle vending machines touch screen vending machine beauty cigarettes tea coffee cold
$ -
>=1 Set
Meo Textile Clothing Co.LTD
small capsule coffee cup outdoor cup coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
6 Axis Robotic Vending Machine Coffee
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Custom Vending Machine Coffee Apple Pay
$ -
>=1 piec
Meo Textile Clothing Co.LTD
FS170 intelligent software control vending machine coffee
$ -
>=2 Set
Meo Textile Clothing Co.LTD
SCENTHOPE Self Service Automatic Coffee Self Heating Drinks Vending Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
automatic vending machine coffee/juice/tea
$ 160 ~ $ 200
>=1 Piece
Meo Textile Clothing Co.LTD
smart combo tea coffee sanitizer tennis ball small vending machine with elevator robot and remote platform
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Smart 24 Hours Automatic Vending Lockers Coffee
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
best price auto tea time vending machine coffee
$ 500 ~ $ 750
>=1 Set
Meo Textile Clothing Co.LTD
New Design Wall Mounted Vending Machine Selling Coffee
$ 599
>=1 Unit
Meo Textile Clothing Co.LTD
Coffee vending for 19 Liter Beer Cola Coffee - vendor vending seller hawker mobile portable
$ 94.53 ~ $ 586.29
>=1 Piece
Meo Textile Clothing Co.LTD
1 year warranty Coffee/Hot Chocolate/Creamer Vending Machines
$ 410
>=1 Set
Meo Textile Clothing Co.LTD
ZIMA high performance cheap price espresso coffee and drink combo automatic vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
high quality automatic locker vending machine with 32 choice for sale soda and canister coffee
$ 650 ~ $ 750
>=1 Set
Meo Textile Clothing Co.LTD
Commercial fully automatic instant coffee maker for hotel- iMIX 3S
$ 380 ~ $ 499
>=1 piec
Meo Textile Clothing Co.LTD
Robot Coffee vending machine kiosk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Self-Service Automatic Instant Coffee and Tea Vending Machine Supplier
$ 140 ~ $ 520
>=1 Set
Meo Textile Clothing Co.LTD
OneCapsule Capsule Coffee vending machine with Dolce Gusto Capsule
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
HV301RD Instant Coffee & Tea Vending Machine(5-Selection)
$ 370 ~ $ 390
>=20 Piece
Meo Textile Clothing Co.LTD
2020 New Coffee Milktea Automatic Robot Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
24 hours fullyautomatic Hot Beverage Tea & Coffee Vending Machine
$ 223 ~ $ 225
>=50 Piece
Meo Textile Clothing Co.LTD
Hot sale lower price automatic vending machine with coin change payment way
$ 250
>=1 Piece
Meo Textile Clothing Co.LTD
Vending machine for tea/coffee/juice/Smoothies/water
$ -
>=2 Piece
Meo Textile Clothing Co.LTD
Rice vending equipment school public places goods selling kit
$ -
>=1 Set
Meo Textile Clothing Co.LTD
canned beverage vending machine and beer coffee vending machine with refrigerator
$ -
>=5 piec
Meo Textile Clothing Co.LTD
Fully Automatic Hot Sale Instant Commercial Coffee Protein Shake Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
KUKA 6 Axis Industrial Robot Arm KR 6 R900 Six Robot Coffee
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic dispenser instant k paper cup noodle vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN hot selling coffee / snack / beverage combo vending machine with CE FCC
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
beervendingmachineforsaletopvendingmachinecompaniesvendingmachineplacementpizzafornovendingmachinenewandusedvendingmachinesvintagevendingwatervendingcandyvendingmachinebusinesscoffeepremixforvendingmachinenestlecoffeevendingmachinemechanicalvendingmachinesmallsnackvendingmachineautomaticcoffeevendingmachinesweetdispensermachinerunningavendingmachinebusinesslaysvendingmachineexpendingmachinevendingmachineshophotvendingmachinesnorthwesternvendingmachinesvendingshopvendingsupplyvendingsystemsilentsalesforcegumballmachine1950scokemachinecoldfoodvendingmachinescontactlessvendingmachineforsaleicecreamvendingmachineforsalecarddispensermachinedrinkmachinenearme