Welcome to TradeChina
-
RELATED CATEGORIES:
hot food vending machine pizza sales vending machine for lunch
$ -
>=2 Set
Meo Textile Clothing Co.LTD
candy tea seling with led display soda bottle water vending machine with card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
smart mini condom vending machine with card reader
$ 990
>=1 Piece
Meo Textile Clothing Co.LTD
Card Reader Electronic Vending Machines Gym Training Fitness Mall Suit Shirt Swimsuit Clothes Vending Machines
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Towel and t shirt vending machine for sale to support card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
bread wine face mask fruit can vending machine with card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Mobile Phone Charger Smart Card Reader Water Toy Vending Machine Big Capacity Mini Mart For Drinking Water Coffee
$ 20 ~ $ 70
>=500 Set
Meo Textile Clothing Co.LTD
Snack Noodle Stationary Book Pen Capsule Tissue Paper Card Reader Beer Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Bluetooth nfc smart card reader with EMV PCI
$ 35 ~ $ 50
>=1 piec
Meo Advertising Co.LTD
Payment kiosk ATM spare parts Automatic Sankyo card reader
$ 170 ~ $ 200
>=1 piec
Meo Textile Clothing Co.LTD
PPE vending machine for face mask sanitizer glasses support card payment
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Robotics Arm Smart Milk Tea Coffee Vending Machine Indoor and Outdoor Vending Machine For Malls and Supermarkets
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
S2 Vending machine with elevator, XY elevator vending machine, fragile commodities vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
cold fresh orange juice vending dispenser machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
PPE, Face Masks Vending Machine (TR616)
$ 460 ~ $ 500
>=10 Piece
Meo Textile Clothing Co.LTD
100% Pure Automatic Orange Juicer Commercial Fresh Orange Juice Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Attractive design pet snack food doggie kitty toys vending machines
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Custom design Lashes Hair Bundles Wigs Beauty Cosmetics Vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
19 inch Floor Standing self-service touch kiosk,bill,health kiosk,vending machine
$ 300 ~ $ 800
>=1 Piece
Meo Textile Clothing Co.LTD
Professional Design Mask Black Vending Machine Combo Hand Sanitizer Face Mask Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
LKS phone card vending machine with card dispenser
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Acess control Card Reader RFID Automatic Vending Freezer For Frozen Food From Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
chip smart card reader writer for vending machine support magnetic/rfid credit/ic card reader SK-AR6
$ 125 ~ $ 180
>=1 Piece
Meo Advertising Co.LTD
Top sales luxury vending machine for lash with card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
magnetic card smart card reader writer for arcade amusement game machine MT188
$ 10 ~ $ 100
>=1 Unit
Meo Textile Clothing Co.LTD
Micron smart fridge vending freezer fruit wine grab n go refrigerator vending machine with credit card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
ZG vending machine with credit card reader / vending machine for canada
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Vending Machines With Card Reader
$ 300 ~ $ 800
>=10 Unit
Meo Textile Clothing Co.LTD
vending machine with card reader
$ 900
>=1 Piece
Meo Textile Clothing Co.LTD
RS232/TTL Ticket Vending Machine/Card Dispenser with IC ID Card Reader
$ 100 ~ $ 150
>=1 Perch
Meo Textile Clothing Co.LTD
Protein Shake Vending Machine with Online Management System Card Reader
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
for kiosk vending machine EMV approved motor auto card reader writer
$ 180 ~ $ 260
>=10 / piece
Meo Advertising Co.LTD
Auto advertising mini card reader snack candy vending machine for sale
$ -
>=2 piec
Meo Textile Clothing Co.LTD
Z70 credit card chip nfc reader writer bluetooth mpos with EMV mPOS
$ 25 ~ $ 49
>=1 Piece
Meo Advertising Co.LTD
AFEN card reader coin operate medical products vending machine with gprs
$ 899
>=1 Set
Meo Textile Clothing Co.LTD
Hot and Cold Espresso Coffee Vending Machine with Card Reader for Credit Card and Debit Card
$ 730
>=5 Piece
Meo Textile Clothing Co.LTD
Card Dispenser(IC, magnetic and RF card Issuing Machine)
$ 190 ~ $ 210
>=1 Unit
Meo Textile Clothing Co.LTD
China manufacturer multifunctional flower flowers vending machine with credit card reader for Europe only
$ -
>=10 Set
Meo Textile Clothing Co.LTD
SNBC BVM-RI211 Condom Toy Vending Machine With Card Reader Refrigerated Sanitary Napkin Jewelry Vending+Machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Rokia Office Small Combo Automatic Distributors Of Drinks Vendor Ce Approved Snack Station Vending Machine With Card Reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
soda vending machine/cheap price vending machine 208A
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Coin operated cared payment system face mask vending machine
$ 220 ~ $ 350
>=1 Set
Meo Textile Clothing Co.LTD
OEM 3 in1 Hybrid Smart Memory Magnetic Card Reader
$ 25 ~ $ 26
>=1000 / piece
Meo Advertising Co.LTD
condom large read plastic stick locker card reader combo vending machines
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Power Bank Sharing Rental Station with 5 Power Banks Self-service Auto Face Surgical Mask Vending Machine for Mask otomat
$ 300 ~ $ 340
>=2 piec
Meo Textile Clothing Co.LTD
OEM/ODM automatic cell phone vending machine/sunglass vending machine with id card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High capacity RFID Card Vending Machine with Recycle Function card reader/TCD-920
$ 280 ~ $ 350
>=1 Piece
Meo Textile Clothing Co.LTD
New Arrive 24 Hours Store Auto Vending Machines To Sell Snacks In School With Credit Card Reader
$ 600
>=1 Piece
Meo Textile Clothing Co.LTD
Coin And Ic Card Reader Smart Payment Sticker Vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Vending machine for dispense for lashes
$ -
>=2 piec
Meo Textile Clothing Co.LTD
Related Searches:
watervendinglavazzavendingantiquecocacolamachinecandymachinetoydrinkmachinenearmetopvendingmachinecompaniesgachavendingmachinecoffeepremixforvendingmachinesmartvendingsolutionscontactlessvendingmachineforsalevendingsupplydonutvendingmachinecashlessvendingmachinesvendingshopoldpepsivendingmachineretrocokemachineusedcokemachinevendingcoffeebianchivendingmachinecolavendingmachinebubblegumvendingmachinesolarpoweredvendingmachinesodacanmachinecakevendingmachinevendingmachinesforsaleebaybestcoffeevendingmachineseyelashvendingmachinepizzafornovendingmachinebusinesseslookingforvendingmachinespeanutvendingmachine