Welcome to TradeChina
-
RELATED CATEGORIES:
2020 New Manufacture Commercial Soft Ice Cream Vending Machine For Sale
$ -
>=3 Set
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner Module
$ 62 ~ $ 75
>=2 piec
Meo Textile Clothing Co.LTD
Hot Sale Reasonable Price Mini Electric Ice Vending Cream Of Machine For Home
$ 385 ~ $ 425
>=1 Set
Meo Textile Clothing Co.LTD
Auto-front Roller shelf for vending machine beverage
$ 8 ~ $ 10
>=100 piec
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare Parts
$ 90
>=10 piec
Meo Textile Clothing Co.LTD
3 hot ice tea drinks coin operated mini coffee vending machine for sale
$ 220 ~ $ 320
>=1 piec
Meo Textile Clothing Co.LTD
Wholesale Self-service Auto Face Mask Vending Machine Dispenser Surgical Mask Vending Machine For Mask Otomat
$ 150 ~ $ 300
>=1 piec
Meo Textile Clothing Co.LTD
XY Hot Sale Newest Soft Ice Cream Vending Machine For School
$ -
>=10 piec
Meo Textile Clothing Co.LTD
ZG OEM/ODM automatic soft ice cream vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 new style intelligent full automatic ice cream vending machine for sales
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2019HOT SELLING VENDING MACHINE REFRIGERATOR ICE CREAM CLAW MACHINE FOR SALE
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Full-automatic coin and bill operated payment soft ice cream vending machine for commercial use
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic soft ice cream vending machine hot sell for teen
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Self Service Ice Cream Vending Machine For Sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2020 automatic soft ice cream vending machine for sale worldwide
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Outdoor Good Price Smart Full Automatic Ice Cream Vending Machine For Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 hot sale ice cream vending machine food fresh beverage machine automatic clooling system vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin Operated Automatic Soft Ice Cream Vending Machine Ice-cream Cone Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
wall ticket mounted can coin mechanism soft power bank vending machines
$ 850
>=1 Set
Meo Textile Clothing Co.LTD
Italian Automatic Soft Ice Cream Vending Machine for sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
ODM/OEM convenience store frozen sucker ice cream vending machine for supermarket
$ -
>=1 Acre(s)
Meo Textile Clothing Co.LTD
Factory Price Hot sale indoor Hypermarket Smart ice cream machine | Supermarket Make money Vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 New Style Intelligent Ice Cream Vending Machine For Sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2020 Hot sale vending machines 5 channels coin operated combo vending machine small vending machine
$ 885
>=1 Set
Meo Textile Clothing Co.LTD
Commercial Automatic Coin Stainless Steel Soft Ice Cream Vending Machine for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2018 New Self-service Automatic Ice Cream Vending Machine on Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN adjustable temperature ice cream frozen meat yogurt food frozen vending machine
$ -
>=3 Set
Meo Textile Clothing Co.LTD
2019 Cosmetic Cigarette Promotion Vending Machine with cashless payment system and ID scanner
$ 357 ~ $ 875
>=30 piec
Meo Textile Clothing Co.LTD
Hot Sale Newest Soft Automatic Ice Cream Vending Machine For School
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Credit Card Vending Machine Ice Cream Soft,Coffee Drink Food E-cigarette Smart Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Ice Cream Vending Machine-Z-400 Frozen Merchandiser
$ -
>=1 Set
Meo Textile Clothing Co.LTD
-25 'C cup ice cream and box ice cream vending machine with elevator
$ -
>=5 piec
Meo Textile Clothing Co.LTD
Tcn Automatic Frozen Food Vending Machine Ice Cream Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Raw milk vending machine for sale ,fresh milk vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 Ice Cream Frozen food vending machine from Vending
$ -
>=1 Set
Meo Textile Clothing Co.LTD
ice cream candy sanitary napkin cosmetic lash eyelash smart touch screen black sale coffee vending machine
$ 290.32 ~ $ 362.9
>=1 piec
Meo Textile Clothing Co.LTD
Automatic milk vending machine milk dispensing machine for milk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Yogurt ice cream vending machines coin operated automatic ice cream vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pasmo New Type Coin Operated Soft Ice Cream Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Touchless ice cream drink advertising screen vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Jstory Vending Bulk Candy Vending Machine for sale with Metal stand Green Black
$ 32 ~ $ 38
>=50 Piece
Meo Textile Clothing Co.LTD
Frozen Yogurt Vending Machine with Refrigerator For Soft Ice Cream
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Ice vending machine with video
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Good Selling Automatic Ice Cream Machine Vending
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
AMA OEM ODM Fresh salad vending machine conveyor belt vending machine with elevator
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
-18C hard stick ice cream vending machine with elevator
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Factory cheap price champagne vending machine wine
$ 849 ~ $ 999
>=1 Piece
Meo Textile Clothing Co.LTD
Cooling drinks fast food snacks can mini mart vending machine with elevator not fall down
$ -
>=1 Set
Meo Textile Clothing Co.LTD
liquid protein shake ice cream burger vending machine automatic
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
drinkvendingmachinenearmevendingmachinelocatorsexpendingmachinehotmealvendingmachinegachavendingmachinecoffeedaymachinecostvendingmachineplacementvendingcoffeeusedcombovendingmachinesbubblegumvendingmachineusedcokemachinevendingsupplysodacanmachinehotvendingmachinesbestsellingvendingmachinecandyvendingshopfooddispensermachinesnacksvendingmachinepricesoftdrinkmachinepriceskittlesvendingmachineforsaledonutvendingmachineeyelashvendingmachinevendingmachineshopcakevendingmachinelaysvendingmachinebeervendingmachineforsalecoffeepremixforvendingmachineoldpepsivendingmachinecappuccinovendingmachineicevendingmachinebusinessforsale