Welcome to TradeChina
-
RELATED CATEGORIES:
Table Coin Type Automatic Serve Vending Coffee Maker Machine Commercial Espresso
$ 185 ~ $ 205
>=1 piec
Meo Advertising Co.LTD
Touch Fully Automatic Espresso Vending Coffee Machine House Appliances
$ 55 ~ $ 60
>=1000 Piece
Meo Advertising Co.LTD
Commercial Automatic Coffee Vending Machine Commercial Coffee Machine
$ -
>=1 piec
Meo Advertising Co.LTD
Dr.Coffee F7+11 italy automatic coffee machine bean to cup small vending machines
$ -
>=1 piec
Meo Advertising Co.LTD
Commercial Vending Espresso Machine Coffee Maker Automatic Coffee Machine BTB-205
$ 290 ~ $ 358
>=1 piec
Meo Advertising Co.LTD
Automatic Vending Machine Paper Cup Emballage eco friendly custom food grade paper fast food packaging
$ 0.01 ~ $ 0.05
>=50000 Piece
Meo household Co.LTD
fashion unique cafe shop commercial automatic vending roaster espresso coffee machine
$ 450 ~ $ 999
>=2 Piece
Meo Advertising Co.LTD
automatic coffee vending machine , bean to cup commercial coffee vending machine
$ 505
>=1 Unit
Meo Advertising Co.LTD
hot sale unique fashion cafe shop commercial automatic vending roaster espresso coffee machine
$ 450 ~ $ 999
>=3 Piece
Meo Advertising Co.LTD
Instant Coffee machine automatic commercial hot coffee maker automatic drink dispenser beverage machine
$ 130 ~ $ 230
>=1 Piece
Meo Textile Clothing Co.LTD
Bar KTV Nightclub Multifunctional Electric Fully Automatic Cocktail Machine Juice Mixed Drink Mixer Layered Drink Machine
$ -
>=1 Pack
Meo Food Co., Ltd.
Orange Juicer Vending Lemon Lime Extractor Machine Automatic with Multi Function
$ 350 ~ $ 400
>=1 Set
Meo Textile Clothing Co.LTD
Non-stick Frying Pan Coating toaster oven suit for Cook Coffee simple Breakfast Machine
$ 18 ~ $ 23
>=1 piec
Meo Advertising Co.LTD
ETON | Best Quality Electric pop orn Vending Machine
$ 80
>=50 piec
Meo Textile Clothing Co.LTD
24 VDC Gearbox Motor for Coffee Vending Machine OD 28mm
$ 3
>=1000 Set
Meo Textile Clothing Co.LTD
commercial rocket appartamento dolce gusto sperso espresso drip tea and coffee maker coffee vender machine
$ 19.65 ~ $ 27.5
>=1 Piece
Meo Advertising Co.LTD
2017 Best price New style High efficiency coffee vending machine/coffee roaster machine
$ 100 ~ $ 699
>=1 Piece
Meo Textile Clothing Co.LTD
Semi-Automatic coffee machine vending italian espresso coffee machine cappuccino coffee maker
$ 458.65
>=1 Set
Meo Advertising Co.LTD
WFJ15 animal food small powder dryer industrial corn mill industri spice crusher industrial coffee grinder machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hight quality expresso coffee machine metal material automatic coffee machine
$ 428 ~ $ 588
>=1 piec
Meo Textile Clothing Co.LTD
mini mart led light coffee tea vending phone accessory machine kiosk touch screen with remote management platform
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Touch Screen Hot Food/ Sandwich Vending Machine Touch Screen Made In Singapore
$ 850
>=10 Piece
Meo Textile Clothing Co.LTD
3 Different Kinds Automatic Coin Operated Tea Time Coffee Vending Machine
$ 215 ~ $ 220
>=10 piec
Meo Advertising Co.LTD
China Factory Suppiler 6 Axis Robotic Arm Robot Serving Coffee
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Coin Operated Tea Time Vending Machine and high quality Commercial Coffee Maker
$ 265 ~ $ 295
>=10 piec
Meo Advertising Co.LTD
hot sale unique cafe shop commercial automatic vending roaster espresso coffee machine
$ 450 ~ $ 999
>=2 Piece
Meo Advertising Co.LTD
Coffee Vending Machine Bean to Cup Automatic
$ -
>=36 Set
Meo Textile Clothing Co.LTD
Nespresso compatible coffee machine espresso
$ 45 ~ $ 60
>=500 Piece
Meo Advertising Co.LTD
wholesale new style cafe shop commercial automatic vending roaster espresso coffee machine
$ 560 ~ $ 999
>=3 Piece
Meo Advertising Co.LTD
WFJ15 industrial corn mill industri spice crusher industrial coffee grinder machine chilli grinding machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Family Health Automatic Black Garlic Induction Cooker Garlic Maker Recycling Intelligent Fermentation Machine
$ 18 ~ $ 25
>=1 piec
Meo Textile Clothing Co.LTD
Factory Wholesale Maker Coffee Vending Machine Coffee-machin
$ 275
>=50 Bag(s)
Meo Advertising Co.LTD
single take away paper wall making cup fan machine tea available holder inside for in roll bottom coffee india raw
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Floor Standing Automatic Coffee Vending with Touch Screen
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Coffee juice beverage vending machine with 19"LCD advertising screen
$ 420 ~ $ 520
>=1 Set
Meo Textile Clothing Co.LTD
High Demand Advanced Instant Tea Coffee Vending Machine for Office, Hotel
$ 140 ~ $ 520
>=1 Set
Meo Textile Clothing Co.LTD
Auto Clean Coffee Automatic Protein Shake Vending Machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Automatic coffee vending machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Commercial Automatic Coin Operated Coffee Vending Machine In Philippines WF1-306B
$ 300 ~ $ 400
>=1 Piece
Meo Textile Clothing Co.LTD
Oem/odm Combo Snack Drink Fully Automatic Coffee Vending Machine With Coin
$ -
>=1 Set
Meo Textile Clothing Co.LTD
hot sale custom water food can bottle drink snack automatic touch screen vending machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
coffee tea vending machine automatic With Touch Screen and Coin Bill Operated
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Commercial Automatic Coin Operated Coffee Vending Machine Tea Feminin Hygiene Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Wifi touch screen advertising display snack pizza coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New development commercial coffee espresso maker automatic coffee machine hot coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Fully automatic capsule coffee vending machine vending machines hot cold drink vending
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Smart Automatic Vending Coffee Machine
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Fully Automatic Instant Coffee Machine -Gaia 3S
$ 150 ~ $ 280
>=1 piec
Meo Textile Clothing Co.LTD
Floor standing type coffee vending machine with 22" LCD screen TCN-CL402(22HP)
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Coffee Machine Commercial Bean to Cup Coffee Vending with Automatic Cup Dispenser
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Related Searches:
nestlecoffeevendingmachinelocalvendingmachinecompaniescommercialvendingmachineicecreamvendingmachineforsalehotmealvendingmachinepeanutvendingmachinenescafecoffeevendingmachinepricesilentsalesforcegumballmachinevendingshopicevendingmachinebusinessnorthwesternvendingmachinesusedsodavendingmachinesforsalenearmesolarpoweredvendingmachinegumvendingmachineusedcokemachinegachavendingmachinedrinkvendingmachinenearmebubblegumvendingmachineantaresvendingmachinesodamachinecostsnacksvendingmachinepricenayaxcardreadersweetdispensermachinesmartvendingsolutionsretrocokemachinevendopepsimachineoldpepsivendingmachineskittlesvendingmachineforsalecappuccinovendingmachinerunningavendingmachinebusiness