Welcome to TradeChina
-
RELATED CATEGORIES:
High speed cheap popsicle shape bags packaging machine
$ 1 ~ $ 2
>=1 Set
Meo Textile Clothing Co.LTD
Automatic flow type foil coin bar chocolate wrapping machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
LOLLIPOP WRAPPING MACHINE
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Flow Pack Packaging Machine For Ice Popsicle/ Ice Cube/Ice cream
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China Joie automatic popsicle packaging machine flow wrapping machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
SS-300S Ice lolly popsicle stick cream wrapping packing machine for business
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory price Auto Flow Ice Cream Bar/Ice Lolly/stick Popsicle Packing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic icelolly / popsicle / Ice Cream packaging machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Ice Lolly Bar / Ice Cream Stick / Popsicle Wrapping Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Horizontal Automatic Flow Ice Popsicle Sticks Packaging Chocolate Bar Wrapping Machine For Small Scale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Horizontal Wrapping Flow Pack Packing Machine Ice Cream Lolly Popsicle Packaging Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Fully automatic horizontal wrapping flow pack packing machine ice cream lolly popsicle packaging machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pillow Shaped Bag Packaging Machine for Popsicle lolly pop ice cream stick wrapping machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic horizontal wrapping flow pack popsicle packing machine ice cream ice lolly packaging machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic horizontal wrapping flow pack packaging machine ice cream lolly popsicle packing machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic small biscuit cookies ice lolly icecream popsicle chocolate protein bars cake bread flow wrapping machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Fully automatic horizontal wrapping flow pack packing machine ice cream lolly popsicle packaging machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory sale low cost automatic popsicle jelly liquid filling sealing stick sachet packing machine
$ -
>=2 Set
Meo Textile Clothing Co.LTD
Lt-110 Automatic Multi Function Small Factory Popsicle Packaging Packing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Snacks Water Peanut Popsicle Sauce Sealing Heat Seed Packaging Tea Box Vertical Pouch Sachet Packing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Easy to operate automatic horizontal pack ice cream lolly popsicle packing machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Vertical Popsicle Ice Lolly Pop Filling Sealing Packing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
filmpackingmachinewrappingmachinepricedoorwrappingmachineflowwrappermanufacturerswrappingequipmentsaranwrapmachineshrinkwrappershrinkwrapbagsealerflowwrappercellophanewrappingmachinecartonwrappingautomaticplasticwrappingmachinestrawwrappingmachineminipackshrinkwrapmachinehandshrinkwrapmachineautomaticpalletwrappercandywrappingmachineforsaleshrinktunnelmachinemachinerollstretchfilmwaterbottleshrinkpackingmachinepalletwrapmachineforsalechocolatewrappingmachinesmallshrinktunnelshrinkpackagingmachineoverwrappingmachinestretchwrappervacuumshrinkwrapmachinemanualsoapwrappingdevicefoodshrinkwrappershrinkwrapmachineamazon