Welcome to TradeChina
-
RELATED CATEGORIES:
Best selling products a252 square wire mesh
$ 15 ~ $ 20
>=1 Roll
Meo Machinery Co.LTD
65 Mn Square Crimped wire mesh Screen vibrating screen mesh Sand Screen Mesh for Afria/South America/Europe countries
$ 3.2 ~ $ 6.9
>=100 square meter
Meo Machinery Co.LTD
Sheep Goat Farm Wire Fence Hot Sale Plastic Fence Mesh Electric Galvanized or Hot Dipped Galvanized Square 2.0mm-2.5mm 25m-100m
$ 32 ~ $ 48
>=10 Roll
Meo Machinery Co.LTD
Cheap Price Plastic Coated PVC Welded Wire Mesh / Electro Galvanized Low Carbon Steel Square Mesh
$ 5 ~ $ 20
>=1000 Roll
Meo Machinery Co.LTD
20 meter plastic welded wire mesh /square hole galvanized iron wire for Aviary Cage Birds small animals
$ 8 ~ $ 20
>=100 Roll
Meo Machinery Co.LTD
Hot Dipped Galvanized Horse / Sheep Wire/Cheap Cattle / Field Fencing
$ 11.6 ~ $ 12
>=50 Roll
Meo Machinery Co.LTD
Plastic 10x10 stainless steel square wire mesh for wholesales
$ 30.6 ~ $ 45.6
>=5 Roll
Meo Machinery Co.LTD
PVC Coated New Euro Holland Wire Mesh Price Welded Wire Mesh Fence Anping Factory Plastic Coated Iron Wire Square
$ 1 ~ $ 5
>=1000 square meter
Meo Machinery Co.LTD
customized 120mesh AISI304 stainless steel plain weave square wire mesh used in plastic pelletizer
$ 5.4 ~ $ 5.8
>=30 Meter
Meo Machinery Co.LTD
Perforated metal mesh for speaker grille
$ 5.89
>=1 Meter
Meo Machinery Co.LTD
PVC Coated Welded Wire Mesh Fencing Green 1/2 x 1/2 Mesh Hole
$ 5 ~ $ 30
>=200 Roll
Meo Machinery Co.LTD
High quality welded rabbit/bird cage wire mesh for exporting
$ 80 ~ $ 100
>=50 Roll
Meo Machinery Co.LTD
PVC Coated Galvanized Welded Wire Mesh For Making crab
$ 6
>=500 Roll
Meo Machinery Co.LTD
Dalian xingbo welded wire mesh fence factory
$ 10
>=100 Piece
Meo Machinery Co.LTD
2*2/4x4 Galvanized Welded Wire Mesh
$ 1.1 ~ $ 5.1
>=10 Roll
Meo Machinery Co.LTD
Fine coffee filter mesh ,food residue filter element ,durable stainless steel wire mesh
$ 0.6 ~ $ 1
>=100 Piece
Meo Machinery Co.LTD
Stainless steel welded wire mesh panel
$ 1
>=1 Piece
Meo Machinery Co.LTD
2*2 galvanized welded wire mesh for fence panel
$ 0.25 ~ $ 15
>=1 square meter
Meo Machinery Co.LTD
reinforcing welded wire mesh
$ 11 ~ $ 15.2
>=50 Roll
Meo Machinery Co.LTD
FACTORY good quality 2" black wire mesh panel
$ 3 ~ $ 40.25
>=300 Sheet
Meo Machinery Co.LTD
12mm*12mm 48inch PVC coated welded wire mesh used in bird/ rabbit/ little dog cages, welded wire fence mesh rolls
$ 5.5 ~ $ 5.8
>=500 Roll
Meo Machinery Co.LTD
High Quality Low Carbon Wire PVC Coated Galvanized Welded Wire Mesh Roll Skilled Welded
$ 0.65 ~ $ 10
>=100 square meter
Meo Machinery Co.LTD
Good anti-corrosion 1x1 light green pvc coated welded wire mesh roll
$ 4 ~ $ 36
>=100 Roll
Meo Machinery Co.LTD
Multifunctional cheap solid steel square iron welded wire mesh 10mm
$ 3.5 ~ $ 38
>=1 Roll
Meo Machinery Co.LTD
Good anti-corrosion 1x1 pvc coated welded wire mesh
$ 5.8 ~ $ 6.5
>=100 Roll
Meo Machinery Co.LTD
Discounted electric galvanized welded wire mesh panell
$ 15 ~ $ 20
>=1 Roll
Meo Machinery Co.LTD
48x50 Hardware Cloth 1/4 inch Square Galvanized Chicken Wire Welded Fence Mesh Roll ( Anping factory )
$ 12 ~ $ 30
>=10 Roll
Meo Machinery Co.LTD
Beautiful PVC coated / hot dipped / electro galvanized / stainless steel Welded wire mesh, welded mesh fence panel (I - 046)
$ 16.3 ~ $ 18.9
>=50 Roll
Meo Machinery Co.LTD
PVC coated welded wire mesh for garden/plastic coated wire mesh panel
$ 350 ~ $ 500
>=1 Ton
Meo Machinery Co.LTD
fine 304 316 material woven stainless steel wire mesh
$ 8
>=300 Meter
Meo Machinery Co.LTD
For Chicken/Rabbit Run Utility With Best Price 1/2 Inch PVC Coated Iron Welded Wire Mesh
$ 21 ~ $ 22
>=100 Roll
Meo Machinery Co.LTD
Related Searches:
plasticpoultryfenceplasticinsectmeshplasticmosquitonetplasticnetpricefineplasticnettingorangeplasticmeshgreenplasticmeshplasticcoatednettingplasticnetfenceplasticmeshwirewovenplasticmeshpvcnetforbalconypvcnettingmeshplastictrellisnettingfineplasticmeshmosquitonetplastichdpenettingplasticnetsforwindowsplasticchickennettingpolyethylenemeshnettingpvcnettingplasticgardennettinghdpenetgreenplasticnettinghardplasticnetpvccoatedpoultrynettingpolypropylenenetplasticsafetynettingrigidblackplasticmeshgardenmeshnetting