Welcome to TradeChina
-
Aloe green tea milk rose gold soap whitening moisturizing wash rase removal pimple pores acne treatment face care and foaming
$ 0.7 ~ $ 0.9
>=1 Piece
Meo Food Co., Ltd.
Best tea tree oil acne pimples removing whitening pigmentation clean clear face wash
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Face wash For Pimples / Branded Face Wash With Brush
$ 1.42 ~ $ 1.65
>=3000 Piece
Meo Food Co., Ltd.
Private Label Oil Control Green Tea Wholesale Best Korean OEM Face Wash For Dry Skin
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Natural Organic Aloe Vera Face Wash Oil Soap Face Cleaner Best Face Wash for Pimples
$ 0.9 ~ $ 1.3
>=20 Acre(s)
Meo Food Co., Ltd.
CICABEL Amino Acid Peptides Soft Facial Cleanser Moisturizing Skin Care Deep Cleaning Face Wash
$ 5 ~ $ 9
>=3 boxe
Meo Food Co., Ltd.
B6715 tea tree acne removing cleanser facial cleansing face wash anti-acne facial cleanser remove pimple cleanser 150g
$ 1.58 ~ $ 1.68
>=24 Piece
Meo Food Co., Ltd.
Best Face Wash For Dry Skin Moisturizing Facial Pore Cleanser
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Korean Green Tea Cleansing Foam Facial Cleanser OEM Lotion Best Face Wash for dry skin
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Face Cleansing 100% Herbal Japanese Facial Foam Cleanser Face Wash for Oily Skin
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Korean Vegan Organic Branded Oil Control Green Tea Face Wash For Acne Wholesale
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
CBD Hemp Oil Extract Chinese Assure Simple Cure Best Cream Face Facial Wash For Acne And Pimples Skin
$ 1.48 ~ $ 2.22
>=200 Piece
Meo Food Co., Ltd.
Private Label Mens Organic Tea Tree Foaming Anti Acne Best Skin Whitening Face Wash
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
YANMEI Turmeric Foaming Face Wash with Chickpea Flour Saffron Almond Extract Rose Water & Sandalwood Oil without Parabens
$ 0.56 ~ $ 3.28
>=2000 Piece
Meo Food Co., Ltd.
Korean Private Label Men Vegan Whitening Moisturizing Facial Wash And Exfoliante Facial Cleanser For Men
$ 1 ~ $ 1.33
>=10 Piece
Meo Food Co., Ltd.
Best Medicated Pigmentation Mens Face Wash for Oily Skin Face Cleanser
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
YANMEI Factory Purifying Charcoal Face Wash for Men oil control Facial Cleanser with Trehalose perlite activated carbon extract
$ 0.7 ~ $ 0.81
>=50 Piece
Meo Food Co., Ltd.
Acne Treatment Acne Face Wash Best Facial Cleanser For Men Wholesale
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
YANMEI 100g Oil-control pimple prevention anti acne Facial Cleanser face wash rich in plant extracts for men and women
$ 0.64 ~ $ 0.75
>=150 Piece
Meo Food Co., Ltd.
Pore Tightening Cleanser Best Cleansing Milk Face Wash for Oily Skin
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Anti Acne Tea Tree Foaming Organic Face Cleanser Wash Private Label For Oily Skin
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 0.6 ~ $ 0.8
>=100 boxe
Meo Food Co., Ltd.
Custom 100g Sea Salt Soap Removal Pimple Pores Acne Treatment Cleaner Moisturizing Goat Milk Face Wash Soap Base Skin Care Savon
$ 0.99 ~ $ 1.09
>=10 Piece
Meo Food Co., Ltd.
Custom 100g Sea Salt Soap Removal Pimple Pores Acne Treatment Cleaner Moisturizing Goat Milk Face Wash Soap Base Skin Care Savon
$ 0.39 ~ $ 1.09
>=1 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 1.06 ~ $ 1.15
>=2 Piece
Meo Food Co., Ltd.
Milk Whitening Herbal Soap Acne Gluta Collagen Face Care Bath Wash Soap Sea Salt Removal Pimple Pores Acne Treatment Goat
$ 2.37 ~ $ 4.47
>=5 piec
Meo Food Co., Ltd.
Body Washing Soap Cleaner Removal Pimple Pores Acne Treatment Moisturizing Face Wash
$ 1.07 ~ $ 1.55
>=100 Unit
Meo Food Co., Ltd.
Sea Salt Soap Removal Pimple Pores Acne Treatment Cleaner Moisturizing Goat Milk Face Wash Sea Salt Soap
$ 0.34 ~ $ 1
>=500 Piece
Meo Food Co., Ltd.
Sea Salt Soap Removal Pimple Pores Acne Treatment Cleaner Moisturizing Goat Milk Face Wash Sea Salt Soap
$ 0.35 ~ $ 1.15
>=1000 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 0.69 ~ $ 1.2
>=10 Piece
Meo Food Co., Ltd.
Hot New USB Rechargeable Blackhead Remover Vacuum Pimple Extractor Acne Face Wash
$ 4 ~ $ 5
>=10 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Care Wash Basis Soap
$ 0.73 ~ $ 1.32
>=10 Piece
Meo Food Co., Ltd.
vacuum pore vacuum blackhead blackhead_remover_pimple face wash for blackheads
$ 16.9 ~ $ 18.9
>=40 Set
Meo Food Co., Ltd.
Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Sea Salt Handmade Soap
$ 0.4 ~ $ 0.8
>=3000 piec
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 0.39 ~ $ 0.78
>=100 boxe
Meo Food Co., Ltd.
OEM Sea Salt Soap Cleaner Removal Pimple Pores Acne Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 0.35 ~ $ 0.68
>=500 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 0.55 ~ $ 0.62
>=3 Piece
Meo Food Co., Ltd.
Sea Salt Soap Removal Pimple Pores Acne Treatment Cleaner Moisturizing Goat Milk Face Wash Soap Base Skin Care
$ 0.43 ~ $ 0.85
>=100 Piece
Meo Food Co., Ltd.
Sea Salt Mite Soap Cleaner Removal Pimple Pores Acne Treatment Body Face Care Wash Basic Soap
$ 0.9 ~ $ 2
>=100 Piece
Meo Food Co., Ltd.
Milk Whitening Herbal Soap Acne Gluta Collagen Face Care Bath Wash Soap Sea Salt Removal Pimple Pores Acne Treatment Goat
$ 1.02 ~ $ 1.38
>=5 Piece
Meo Food Co., Ltd.
Natural Organic Sea Salt Soap Cleaner Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade whitening Soap
$ 0.58 ~ $ 0.98
>=10 Piece
Meo Food Co., Ltd.
Private Label Organic Kojic Acid Soap Handmade Face Wash for Oily Skin Whitening Facial Cleanser Papaya Soap
$ 3.4 ~ $ 4.8
>=4 Piece
Meo Food Co., Ltd.
100g Natural Organic Sea Salt Essential Oil Soap Whitening Handmade Goat Milk Soap For Remove Skin Acne Deep Cleansing Face Care
$ 0.9
>=100 Box(es)
Meo Food Co., Ltd.
Black Heads Acnes Pimples Removing Skin Care Tea Tree Oil Soap
$ 0.99 ~ $ 2.65
>=100 Piece
Meo Food Co., Ltd.
Hyaluronic Acid Ginseng Extract Face Cleanser Facial Scrub Cleansing Acne Treatment Blackhead Remover Pimples Pores Skin Care
$ 1.98 ~ $ 2.3
>=20 Piece
Meo Food Co., Ltd.
Natural Sea Salt Soap 100g Organic Hand Soap Moisturizing Face Care Goat Milk Soap Glycerin Removal Pimple Anti Acne Treatment
$ 1.29 ~ $ 1.39
>=5 Piece
Meo Food Co., Ltd.
Acne Treatment Cure Gel Natural Scar Acne Removal Best Face Wash for Acne Scars Treatment Personal Skin Care
$ 1.49 ~ $ 1.89
>=200 Acre(s)
Meo Food Co., Ltd.
Wholesale Hand Made Anti Acne Remove Pimples Natural Organic Herbal Soap
$ 2.24 ~ $ 2.39
>=2 Piece
Meo Food Co., Ltd.
OEM ODM Hot to get rid of blackheads on nose big black head pimple best way off your face wash products for women
$ 1.12 ~ $ 1.78
>=100 Piece
Meo Food Co., Ltd.
Natural Sea Salt Soap 100g Organic Hand Soap Moisturizing Face Care Goat Milk Soap Glycerin Removal Pimple Anti Acne Treatment
$ 1.29 ~ $ 1.39
>=5 Piece
Meo Food Co., Ltd.
Related Searches:
glycolicfacewashfacecleanserforacnegoodfacialcleansergoodfacewashforcombinationskinfacialcleansingoilkoreanfacewashbestwaterbasedcleanserbestfacialcleansingbrush2018bestfacewashforsensitivecombinationskintop5facewashbiothermfacewashbestwhiteningfacewashcleanandclearoilfreefacewashchemicalfreefacewashbestfacewashforoilyacneproneskineltamdfoamingfacialcleanseraloefacewashoilofolayfacewashveganfacewashcetaphilfacewashgoodfacewashforacnebestbenzoylperoxidefacewashmarykayfacewashgentlefacecleanserforeofacecleanseraminoacidcleanserneutrogenadeepcleanfacewashfacewashforacneproneskincetaphilgentlefacewashdovefacialcleanser