Welcome to TradeChina
-
Wholesale PP modified particles Polypropylene Modified Melt blown PP raw materials Reinforced Recycled Plastic Particles
$ 3 ~ $ 3.3
>=1000 Kilogram
Meo household Co.LTD
Sinopec raw Material pp Polypropylene Polypropylene Homopolymer Of China pp Producer 25kg
$ -
>=20 Ton
Meo household Co.LTD
dark gray recycled plastic pp random copolymer compounding pp gf20
$ 0.8 ~ $ 2.5
>=25 Kilogram
Meo household Co.LTD
Polypropylene resin Virgin&Recycled PE/PP/ABS/PS/PVC granules PP granules for woven bag
$ 100
>=1 Kilogram
Meo household Co.LTD
Cheap Price plastic injection molding natural polypropylene pellets / Crystal PP Granules
$ 1.08 ~ $ 1.21
>=25 Kilogram
Meo household Co.LTD
Polypropylene
$ 1
>=10000 kilograms
Meo household Co.LTD
Free Sample Virgin Polypropylene PP resin Granules pellets
$ 1.08 ~ $ 1.21
>=25 Kilogram
Meo household Co.LTD
film grade raw material bopp resin granule Polypropylene Virgin&Recycled hdpe/ldpe/lldpe/pp granules for bag/film/tape
$ 100
>=1 Kilogram
Meo household Co.LTD
2.5 inch/63mm light duty PP/rubber Orientation casters drive wheel , 100mm air cargo caster
$ 0.23 ~ $ 0.42
>=200 Piece
Meo Textile Clothing Co.LTD
Hot Packaging Film Biaxially Oriented Polypropylene Anti Fog made in Malaysia
$ 1.7 ~ $ 2.5
>=1000 Kilogram
Meo household Co.LTD
Transparent sterilization biaxially oriented polypropylene film
$ 5.5 ~ $ 15
>=500 Kilogram
Meo household Co.LTD
China 5kg 10kg 15kg Cut Handle PP Woven Charcoal Packaging Bag Custom Woven Polypropylene Charcoal Bags for Sale
$ 0.3 ~ $ 0.31
>=10000 pieces
Meo household Co.LTD
100% pp mat in roll
$ 2 ~ $ 6
>=200 pieces
Meo Food Co., Ltd.
Oriental Room Floorsam Shoes Cleaning PVC Backing Polypropylene Rug
$ 0.1 ~ $ 1.89
>=1 Piece
Meo Food Co., Ltd.
Biaxial Oriented Polypropylene Film BOPP Material film
$ 1.82
>=1000 kilograms
Meo household Co.LTD
Polypropylene Bright pattern woven plastic mat
$ 2.87
>=3000 Meter
Meo Food Co., Ltd.
Spunbond Polypropylene Material SMS Nonwoven Fabric
$ 1.82 ~ $ 2.98
>=500 fabric
Meo Electronic Technology Co.LTD
Bopp flim Biaxially oriented polypropylene film
$ 0.5 ~ $ 1
>=100 kilograms
Meo household Co.LTD
4/5/6/8inch Heavy duty Orientation rubber tire outdoor outside caster
$ 2.53 ~ $ 2.8
>=20 Piece
Meo Textile Clothing Co.LTD
Woven technics and 100% polypropylene material area rug home wilton rug
$ 7.5 ~ $ 10.6
>=50 meters
Meo Food Co., Ltd.
wholesale polypropylene sunflower design pp plastic plates chargers for catering
$ 1.3 ~ $ 1.45
>=300 piec
Meo Food Co., Ltd.
500ml, 650ml, 800ml BPA Free Polypropylene (PP) Plastic Custom Logo High Quality Plastic Beverage Protein Shaker with Lid
$ 0.49 ~ $ 0.76
>=1500 Unit
Meo Food Co., Ltd.
Glossy film bopp laminating film for photo book prints biaxially oriented polypropylene plain film
$ -
>=1 Ton
Meo household Co.LTD
Factory hot sales pp floor mat polypropylene double stripe carpet
$ 3.54 ~ $ 4.5
>=1000 square meter
Meo Food Co., Ltd.
China Xiamen Inch biaxially-oriented polypropylene bopp foil for cigarette packing
$ 3 ~ $ 7
>=3 Kilogram
Meo household Co.LTD
Hot selling Polypropylene disposable non woven shoe cover dust proof breathable easy to use and wear off shoe cover
$ 0.01 ~ $ 0.07
>=50000 Piece
Meo Food Co., Ltd.
Anti slip waterproof polypropylene plastic floor mat roll
$ 20 ~ $ 25
>=500 pieces
Meo Food Co., Ltd.
2019 Top selling azure color biaxially oriented polypropylene film
$ 1.36 ~ $ 1.95
>=1000 Kilogram
Meo household Co.LTD
Single Use Doctor Cap With Back Elastic Rubber For Medical Using In Hospital By Polypropylene+SMS
$ 0.02 ~ $ 0.5
>=100000 Piece
Meorient Biotechnology Co.LTD
two layer pe film coated non woven pe film laminated with PP nonwoven composite nonwoven fabric
$ -
>=1 Ton
Meo Electronic Technology Co.LTD
PP Fabric And Action Backing Gray Carpet Stair Treads Mats
$ 0.78 ~ $ 0.92
>=2000 Piece
Meo Food Co., Ltd.
22micron Matte BOPP Biaxially Oriented Polypropylene Film Rolls Coating EVA glue
$ 2.1 ~ $ 2.5
>=500 kilograms
Meo household Co.LTD
Acrylic Coating BOPP/ Biaxially Oriented Polypropylene Film Roll
$ 2.23 ~ $ 3.69
>=500 Kilogram
Meo household Co.LTD
Transparent biaxially oriented polypropylene films
$ 2.2 ~ $ 3.3
>=1000 Kilogram
Meo household Co.LTD
Luxe Weavers Hampstead Oriental Blue 8x10 Area Rug 5623
$ 150
>=1 Piece
Meo Food Co., Ltd.
Price Offer Biaxially Oriented Polypropylene Rolls BOPP Film
$ 3 ~ $ 6
>=1 Kilogram
Meo household Co.LTD
High quality pe film laminated coated with PP nonwoven fabric
$ -
>=1 Ton
Meo Electronic Technology Co.LTD
High Corona Treatment Metallized Biaxially Oriented Polypropylene film
$ 1.68 ~ $ 1.7
>=1000 Kilogram
Meo household Co.LTD
Related Searches:
shrinkwrapfilmpolyethyleneplasticfilmbiodegradableplasticsheetsuvresistantclearplasticsheetinglexan8010greenhouseplasticsheetingpricemulchingplasticselfadhesiveplasticsheetpvcclingfilmpolythenesheetforconstructionlexanfilmclearplasticsheetsforgreenhouseoppplasticpolyethylenefilmpolyolefinshrinkfilmpricefoodcoverplasticsheetpvcfilmpricepvcfilmsheetspolyfilmheatresistantplasticfilmpvcshrinkwrapagriculturalplasticfilmheatshrinkplasticwrapblackmulchfilmuvplasticforgreenhouseoppcppplasticheatshrinkfilmfilmpolyethylenebuildersfilmclingfilmamazon