Welcome to TradeChina
-
RELATED CATEGORIES:
Chinese Flavour Sichuan Pepper Paste Red Chili Sauce
$ 5.8 ~ $ 8.1
>=12 Pack
Meo Auto Parts Co.LTD
KINJIRUSHI Food Seasoning Sauce Spice Selection Yuzu Pepper Paste For Wholesale
$ 270
>=5 cartons
Meo Auto Parts Co.LTD
Wholesale 1.5Kg *6 Pcs Spicy Red Pepper Chili Paste Sauce For Cooking Food
$ 29.55
>=6 pieces
Meo Auto Parts Co.LTD
BOBOJI PURE NATURE CHILI SAUCE PEPPER Paste SPECIAL CONDIMENTS
$ 50
>=10 Unit
Meo Auto Parts Co.LTD
[Made in Korea] Gochujang Tteokbokki Sauce Spicy Chili Paste Korean Hot Chili Pepper Paste
$ 1.56 ~ $ 27.3
>=80 Piece
Meo Auto Parts Co.LTD
Korean Red Pepper Paste Product Gochujang Doenjang and Ssamjang Paste
$ 0.6 ~ $ 15
>=10 box
Meo Auto Parts Co.LTD
ROCOTO HOT CHILI PEPPER PASTE OEM Gochujang, Turkish Red Pepper Paste, Red Hot Chili Pepper Paste
$ 0.5 ~ $ 1.5
>=1000 Kilogram
Meo Auto Parts Co.LTD
[Made in Korea] Tteokbokki Sauce Gochujang Spicy Chili Paste Korean Hot Chili Pepper Paste
$ 1.56 ~ $ 27.3
>=80 Piece
Meo Auto Parts Co.LTD
Korean traditional Red pepper paste called Gochujang
$ 100
>=100 Box(es)
Meo Auto Parts Co.LTD
Korean Mixed Seasonings Spices Sauce Red Pepper Paste Product Gochujang Paste
$ 0.9 ~ $ 1.5
>=1 pieces
Meo Auto Parts Co.LTD
[Made in Korea] Gochujang Korean pepper paste Tteokbokki Spicy Sauce Hot Chili Pepper Sauce
$ 1.56 ~ $ 27.3
>=80 Piece
Meo Auto Parts Co.LTD
Gochujang
$ 0.62 ~ $ 16.6
>=1 twenty-foot container
Meo Auto Parts Co.LTD
Korean Mixed Spices & Seasonings Red Pepper Paste Product Gochujang Paste
$ 0.9 ~ $ 1.5
>=1 pieces
Meo Auto Parts Co.LTD
[Made in Korea] Gochujang Tteokbokki Sauce Spicy Deep Chili Paste Korean Hot Chili Pepper Paste Origin Kore
$ 1.56 ~ $ 27.3
>=80 Piece
Meo Auto Parts Co.LTD
Korean Food Ssamjang Paste for Bibimbap
$ 0.4 ~ $ 0.7
>=2 boxes
Meo Auto Parts Co.LTD
Korean Food Mixed Spices & Seasonings Gochujang Doenjang and Ssamjang Paste
$ 0.6 ~ $ 15
>=1 Box(es)
Meo Auto Parts Co.LTD
1600164471212 1/6 Rich in vitamin B calcium iron protein Nutrition Organic Black Red White Three color brown Mixed rice
$ 200 ~ $ 350
>=50 metric ton
Meo Auto Parts Co.LTD
Related Searches:
asianchilipeppersaucelaoganmachilioilcookingwithchilioilmaddogchilichillisaucesrirachagarlicandpeppersaucechiligarlicoilchillidogsaucechilibeanpastelaoganmapeanutsinchillioilgochujangkoreanchilisauceheinzchilliketchupsweetchilioilsichuanchilioilbrandfermentedchillisaucemexicanredchilichilligingersaucecannedhotdogchiliabcextrahotchillisaucecarolinareaperchilisaucespicychilicrispfriedsweetchiliwingschilicrispkraftchilisaucecannedchipotlechileskoreanchilibeanpasteheinzhotpeppersaucesweetchiligochujangsaucechilisospricehomemadechilioil