Welcome to TradeChina
-
RELATED CATEGORIES:
Programmable Time Switch Digital Time Switch Time Control Switch 16A LCD Display
$ 9 ~ $ 11.7
>=100 Piece
Meo Advertising Co.LTD
DQ001 Staircase Timer 16A 30s to 10mins Time Switches For Street Light
$ 3.85 ~ $ 6.15
>=1 pieces
Meo Advertising Co.LTD
manual timer Time Switch sul181h for swimming pool
$ 5 ~ $ 7
>=100 Piece
Meo Advertising Co.LTD
7 Day Heavy Duty Digital In Wall Time Switch with Neutral Wire
$ 7.5 ~ $ 15
>=1000 pieces
Meo Advertising Co.LTD
ALION AHC812 220V-240V Programmable Time Switch, Digital Time Switch
$ 9.9 ~ $ 12.3
>=1 pieces
Meo Advertising Co.LTD
TM615 YP15A THC15A DHC15A Microcomputer Control Switch 35mm Rail Timer Switch
$ 3.09 ~ $ 3.26
>=1 Piece
Meo Advertising Co.LTD
THC15A 220V industrial digital din rail weekly timer switch manual mechanical time switch
$ 3.86 ~ $ 4.55
>=100 Piece
Meo Advertising Co.LTD
DC 12V 24V Home Automation Delay Relay Trig ger Time Circuit Timer Control Cycle Adjustable Switch Relay Module
$ 2.35 ~ $ 2.71
>=10 Piece
Meo Advertising Co.LTD
GEYA THC15A Time Switch Weekly Program DIN Rail LCD Digital 16A Timer Switch DC12V 24V 48V AC110V 220V
$ 4.68 ~ $ 5.93
>=1 Piece
Meo Advertising Co.LTD
ATHC15A Digital Programmable 24 Hour Program Timer Time Switch 16A 220V AC
$ 5.5 ~ $ 6.75
>=1 Piece
Meo Advertising Co.LTD
KG316T Programmable digital countdown daily time switch
$ 2 ~ $ 4
>=10 Piece
Meo Advertising Co.LTD
DH48S DH48S-S repeat cycle SPDT timer time relay with socket DH48S series delay timer
$ 3 ~ $ 3.5
>=10 Piece
Meo Advertising Co.LTD
YP15A THC15A Microcomputer Control Switch 35mm Rail Timer Switch
$ 2 ~ $ 3.5
>=1 Piece
Meo Advertising Co.LTD
Manhua KG316T Time Timer Switch AC110-240V
$ 2.5 ~ $ 4
>=1 Piece
Meo Advertising Co.LTD
AHC15A THC15A 220V 110V 24V 12V 16A 30A LCD Display Daily Weekly Programmable Digital Timer Switch
$ 3 ~ $ 4.1
>=10 Piece
Meo Advertising Co.LTD
Heavy Load 5000W Digital Timer Switch Programmable 24hrs Automatic Switch for LED Lighting Loading ON/OFF
$ 4.88 ~ $ 5.48
>=1 pieces
Meo Advertising Co.LTD
DHC15A(AHC15A) programmable digital timer switch with battery
$ 3.56
>=100 Piece
Meo Advertising Co.LTD
THC15A AC 220V 16A Din Rail Mount timer switch Digital Timer Relay
$ 4 ~ $ 10
>=1 Piece
Meo Advertising Co.LTD
Heavy load digital timer switch for LED lighting loading on/off
$ 3.69 ~ $ 4.28
>=10 Piece
Meo Advertising Co.LTD
Intelligent microcomputer Auto bell ring timer controller school bell 220V ZYT08 80 times one day, programmable school bell time
$ 14
>=1 Piece
Meo Advertising Co.LTD
Programmable 24 Hour Timer Switch TB-45 Relay Electrical Switch
$ 4 ~ $ 5
>=10 Piece
Meo Advertising Co.LTD
JVR800-2 Under Over Voltage Protector 3 Phase Voltage Monitoring Sequence Protection Relay New
$ 19 ~ $ 20
>=1 Piece
Meo Advertising Co.LTD
Low Price Automatic Electrical Timer Switch for Water Pump
$ 4.5 ~ $ 5.4
>=1 pieces
Meo Advertising Co.LTD
QIANJI 2020 China Suppliers AHC15A 110V Auto Timer Relay 12V 24V DC
$ 3.1 ~ $ 4.2
>=100 Piece
Meo Advertising Co.LTD
DAQCN China DHC15A Weekly Programmable Timer Digital Timer Switch
$ 2.3 ~ $ 4.6
>=100 piece
Meo Advertising Co.LTD
12V Weekly programmable electronic timer(THC-101A, CN101A)
$ 3.86 ~ $ 4.55
>=100 Piece
Meo Advertising Co.LTD
FATO THC15A/15B Digital Programmable Time Switches
$ 4.37
>=10 Piece
Meo Advertising Co.LTD
Related Searches:
switchontimerlightswitchsensortimerdimmerandtimerswitchdigitalwallswitchtimersecuritylighttimerswitch24hourprogrammabletimerswitchtimerlightswitchsuitableforledcountdowntimersocketastronomicallighttimerpanasonic24hourtimerswitchdigitaltimerplugstimedelayswitch220vselectimeswitchwinduptimerswitchtorkspringwoundtimerweeklytimeswitchlightswitchtimersforhomesecurityelectricaldelayswitchl701digitaltimerswitchtimerlampswitchdigitalsecondstimerswitchprogrammabletimedelayswitchdawntodusktimerswitchtimerdimmerlightswitchpushtimerlightswitchaquariumtimerswitch120vtimerwallswitchbatteryoperatedlightswitchtimersecondstimerswitch16atimerswitch