Welcome to TradeChina
-
RELATED CATEGORIES:
Factory Outlet High Carbon Steel Wire Chicken Layer Cage for Layer Chicken Breedingly
$ 130 ~ $ 150
>=20 Set
Meo Textile Clothing Co.LTD
Online shopping hot sale poultry cage with different sizes
$ 90 ~ $ 149
>=20 Set
Meo Textile Clothing Co.LTD
Vincent Diet Puppy Dog 3Kg Bulk Dry Complete Chicken Dog Food Manufacture
$ 6.15 ~ $ 6.27
>=990 Bag(s)
Meo Food Co., Ltd.
Factory HDPE Plastic Screen Mesh for Chicken Wire Netting
$ 0.35 ~ $ 3.8
>=100 square meter
Meo household Co.LTD
VincentLife Active 15Kg Dry Wholesale Dog Food 15Kg All Natural Dog Food
$ 12.91 ~ $ 13.03
>=528 Bag(s)
Meo Food Co., Ltd.
VincentDiet Puppy 15Kg Pet Food Dry Dog Growth Dog Food Natural Wholesale Big Container
$ 22.03 ~ $ 22.05
>=1400 Bag(s)
Meo Food Co., Ltd.
VincentDiet Puppy 15Kg Pet Food Dry Dog Organic Dog Food Natural Wholesale
$ 22.13 ~ $ 22.25
>=528 Bag(s)
Meo Food Co., Ltd.
VincentDiet Puppy 3kg Dry Food Dog Bag With Handles Dog Food Natural
$ 6.15 ~ $ 6.27
>=990 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 15Kg Cheap Dry Dog Food Flavour
$ 22.12 ~ $ 22.13
>=1400 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 15Kg Dry Dog Food Healthy Dry Food Dog
$ 22.03 ~ $ 22.05
>=1400 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 15Kg Dry Dog Food Snaks Adult Dog Food Big Bags
$ 22.12 ~ $ 22.13
>=1400 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 15Kg Dog Food High Performance Bulk Dog Food 15Kgs Medium
$ 22.03 ~ $ 22.05
>=1400 Bag(s)
Meo Food Co., Ltd.
Vincentlife Active Dry Adult Dog Food Travel Bulk
$ 12.44 ~ $ 12.56
>=528 Bag(s)
Meo Food Co., Ltd.
Vincentlife Active Pet Food Bag Adult Dog Food Label
$ 12.91 ~ $ 13.03
>=528 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 3Kg Dry Dog Food Bulk Eating Food Dogs
$ 6.15 ~ $ 6.27
>=990 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 3Kg Dry Dog Food Food Adult Pet Food Dry Dog
$ 6.13 ~ $ 6.25
>=990 Bag(s)
Meo Food Co., Ltd.
Vincent Diet Puppy Dog 3Kg Dog Dry Food Puppy Dry Dog Food High Protein Wholesale
$ 6.13 ~ $ 6.25
>=990 Bag(s)
Meo Food Co., Ltd.
Related Searches:
kadaknathchickenmeateasyhomemadechickennoodlesoupwhitechickenchilislowcookerkfchotandcrispybantamroosterfrozenchickenwingsbuffalohotwingscheesychickenenchiladaschickeninthecrockpotsilkiechickensforsaleorganicchickenbreastrhodeislandredroosterchickenchicksilkiebantamhatchingchickeneggscookedchickenbreastchickenbreastpricenonvegbiryanichickenhotdogsfluffychickensquailchickschickeninabageasybutterchickenchickenglassesmicrowavechickenkadaknathpricelivechickensforsalebroilerfarminghensforsalenearmebreadedchickenwings