Welcome to TradeChina
-
RELATED CATEGORIES:
Quality Assurance Medical Grade Materials Remove Acne Repair Moisturizing Cover for Facial Repair
$ 13.65 ~ $ 16.49
>=110 pieces
Meo Food Co., Ltd.
Clay mask stick on face new green mud pink facial self sticking masks matcha white tea cream clean face mask
$ 0.95 ~ $ 1.09
>=2 Box(es)
Meo Food Co., Ltd.
Beauty Care Product Natural Pimple Extractor Moisturizing Acne Dead Sea Mud Mask For Women Skin Care
$ 4.5 ~ $ 7
>=2 pieces
Meo Food Co., Ltd.
Face Mask Green Tea Clay Oil Control Deep Cleaning Blackhead Remover Purifying Shrinks Pores Nourishing Acne Treatment Mask
$ 0.99 ~ $ 1.36
>=1 Piece
Meo Food Co., Ltd.
Wholesale Deep Cleaning Clay Facial Mask Purple EggPlant Green Tea Mud Mask Green Mask Stick
$ 1.85 ~ $ 1.99
>=1000 pieces
Meo Food Co., Ltd.
Factory Price Best Sleeping Facial Mask Whitening and Moisturizing to Prevent Acne Salicylic Acid Ice Cream Mask
$ 1.43 ~ $ 1.57
>=11 Piece
Meo Food Co., Ltd.
Cosmetic green mask stick free sample
$ 1.13 ~ $ 1.81
>=3 piec
Meo Food Co., Ltd.
Free Sample Private Label organic Green Tea Clay Face Mask Stick Deep Cleansing Blackhead Remover Acne Treatment
$ 2.2 ~ $ 2.5
>=1000 Piece
Meo Food Co., Ltd.
Clay mask stick on face new green mud pink facial self sticking masks matcha white tea cream clean face mask
$ 0.95 ~ $ 1.2
>=2 pieces
Meo Food Co., Ltd.
Dead Sea mud mask hydrating and moisturizing cleaning skin improving dark yellow Skin care products manufacturer
$ 1 ~ $ 1.4
>=2 pieces
Meo Food Co., Ltd.
Bioaqua remove blackhead mask clean the pore in best sell black mask
$ 0.41
>=144 Piece
Meo Food Co., Ltd.
OEM/ODM Blackhead Remover Deep Cleaning Oil Control Korean Facial Mask Black Peel Off Natural Mask Bamboo Charcoal Mask
$ 1.29 ~ $ 1.79
>=59 pieces
Meo Food Co., Ltd.
3 Steps Blackhead Mask Nose Pore Deep Clean Strip Acne Treatment Mask Nose Sticker Cleaner Blackhead Remove Nose Strip
$ 0.11 ~ $ 0.15
>=10 pieces
Meo Food Co., Ltd.
ROUSHUN egg white pore mask intense hydration tightens enlarged pores clears small breakouts and acne
$ 0.79 ~ $ 0.99
>=96 pieces
Meo Food Co., Ltd.
2020 collagen facial mask deep cleaning face mask 24k gold face mask
$ 1.21 ~ $ 1.3
>=100 Piece
Meo Food Co., Ltd.
Anti Acne Clean Pores Moisturizing Tightening Charcoal Cleanse Deep Sea Mineral Mud Peel-Off Black Head Remove Facemask
$ 1.36 ~ $ 2.13
>=100 pieces
Meo Food Co., Ltd.
KOREAN SKINCARE COSRX ACNE PIMPLE MASTER PATCH - 1PACK (24PCS)
$ 1 ~ $ 2
>=100 Piece
Meo Food Co., Ltd.
OEM BIOAQUA Pig Nose Mask Remove Blackhead Acne Clean 3 Step Kit Clear Black Head Nose Mask
$ 0.2
>=480 Piece
Meo Food Co., Ltd.
Private Label Anti Acne Deep Skin Clean Eggplant Refine Pores Moisturizing Face Clay Mask Beauty Stick
$ 1.64 ~ $ 2
>=100 piec
Meo Food Co., Ltd.
Effective Deep Clean Absorb Oil Gently Exfoliate Pore Detox Black Charcoal Clay Charcoal Facial Mask Stick
$ 0.95 ~ $ 1.32
>=100 pieces
Meo Food Co., Ltd.
Private label natural deep cleaning exfoliating charcoal blackhead black acne mask with brush
$ 0.95 ~ $ 2.75
>=1000 Piece
Meo Food Co., Ltd.
Private label Rose pomegranate Mud mask Brightening Anti-aging Deep Cleaning Reduce Acne Rose Pink Clay Mask
$ 1.85 ~ $ 2.2
>=5 pieces
Meo Food Co., Ltd.
free sample acne detox carbon face mask skincare carbonated mud bubble clay mask
$ 0.85 ~ $ 1.85
>=2 boxes
Meo Food Co., Ltd.
Centella Mud Detoxifying Face Mask White Clay Mask Deep Cleaning Remover Blackhead Acne Hydrating Facial Clean Mud Mask
$ 0.77
>=48 Piece
Meo Food Co., Ltd.
High Quality Natural Organic Volcanic Face Mud Mask Deep Pore Cleaning Soothing Facial Mask
$ 1.4 ~ $ 1.8
>=500 Piece
Meo Food Co., Ltd.
Wholesale Amino Acid whitening anti acne cleansing foam
$ 3 ~ $ 4.15
>=1 Piece
Meo Food Co., Ltd.
Rose Peptides Blackhead Remover Nose Mask Acne Treatment Pore Strip Black Mask Peeling Black Head Deep Clean Skin Care Face Mask
$ 0.42 ~ $ 0.51
>=3 pieces
Meo Food Co., Ltd.
Wholesale OEM/ODM High Quality Reduces Fine Lines Acne Clean Pores 24 Gold Facial Mask 250g
$ 2.4 ~ $ 2.77
>=500 boxe
Meo Food Co., Ltd.
Green tea tree fruit extract moisturizing Night use acne pimple patch collagen facial
$ 1.3
>=20 Piece
Meo Food Co., Ltd.
Custom logo 250g mineral reduces wrinkles anti acne anti aging dead sea mud mask facial care Guangzhou manufacturer
$ 2.46 ~ $ 3.08
>=100 pieces
Meo Food Co., Ltd.
Pore Treatment Serum Facial Mask Glossy Oil Control Skin Care Fade Puffy Eyes Moisturizing Delicate Fresh Anti Wrinkle
$ 0.64 ~ $ 0.72
>=40 Piece
Meo Food Co., Ltd.
Anti Acne Clearing Pores Purifying Hydrating Cleaning Facial Clay Mask
$ 1.9 ~ $ 2.1
>=1000 pieces
Meo Food Co., Ltd.
Matcha Green Tea Facial Detox Mud Mask with Aloe Vera, Deep Cleaning, Hydrating, Detoxing, Healing Volcanic Clay Facial Mask
$ 1.2 ~ $ 2.5
>=500 boxe
Meo Food Co., Ltd.
Envisha OEM black mask custom logo private label blackhead peel off face mask bamboo charcoal cleaning mask
$ 0.85 ~ $ 1.1
>=2 pieces
Meo Food Co., Ltd.
Related Searches:
lightfacecreambestaffordablemoisturizerfordryskinegyptianmilkfacecreamthebestmoisturizerforsensitiveskinniveasoftrefreshinglysoftmoisturisingcreamnourishfacecreamfacecreamforextremelydryskinbestskinmoisturizerforoilyskinpinkfacecreamcocoabutterlotiononfacebestmensmoisturizerforoilyskinoilfreewaterbasedmoisturizerceravemoisturizingcreamforoilyskineucerinwrinklecreamantiagingfacemoisturizerbestoilcontrolcreamformensbestwaterbasedmoisturizerforoilyskinmostmoisturizingfacecreambestmoisturizerfordrysensitivefacenoncomedogenicfairnesscreamvanicreamfacemoisturizerdermatologistrecommendedfacecreammensfacecreamfordryskinsheamoisturefacecreamgoodmoisturizingcreambestniveafacecreambestdaycreamfornormalskincucumbercreamforfacebestdailyfacecreamforoilyskinbestoilfreemoisturizerforacneproneskin