Welcome to TradeChina
-
Best quality moisturizing anti acne clean and clear face skin whitening face wash for pimples
$ 2.5 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Wholesale Pure Nature Moisturizing Balance Oil Hydrating Anti Acne Pimples Face Fresh Face Cleanser Cream Face Wash
$ 0.8
>=5000 Piece
Meo Food Co., Ltd.
OEM Organic Mild Acne Exfoliating Daily Face Wash
$ 2.35 ~ $ 2.5
>=2000 Piece
Meo Food Co., Ltd.
Private Label Oil Control Green Tea Wholesale Best Korean OEM Face Wash For Dry Skin
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Face Wash For Dry Skin Moisturizing Facial Pore Cleanser
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Mint and Witch Hazel Infused Organic Aloe Vera Blemish Control Facial Cleanser for Clearing Pores on Oily Skin
$ 2 ~ $ 8.43
>=1 Piece
Meo Food Co., Ltd.
B6715 tea tree acne removing cleanser facial cleansing face wash anti-acne facial cleanser remove pimple cleanser 150g
$ 1.58 ~ $ 1.68
>=24 Piece
Meo Food Co., Ltd.
Private Label Mens Organic Tea Tree Foaming Anti Acne Best Skin Whitening Face Wash
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Face Cleansing 100% Herbal Japanese Facial Foam Cleanser Face Wash for Oily Skin
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
High Quality Wash Private Label Vitamin C Vc Face Cleanser Mask
$ 1.5 ~ $ 2.8
>=120 Piece
Meo Food Co., Ltd.
Korean Green Tea Cleansing Foam Facial Cleanser OEM Lotion Best Face Wash for dry skin
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Pore Tightening Cleanser Best Cleansing Milk Face Wash for Oily Skin
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Korean Vegan Organic Branded Oil Control Green Tea Face Wash For Acne Wholesale
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best tea tree oil acne pimples removing whitening pigmentation clean clear face wash
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Sea Salt Soap Cleaner Removal Pimple Pores Acne Treatment Goat Milk Moisturizing Face Wash Soap Skin Care Handmade Soap
$ 1.06 ~ $ 1.15
>=2 Piece
Meo Food Co., Ltd.
facial cleansing brush spin and vibrate clean clear face wash
$ 3 ~ $ 6
>=100 Piece
Meo Food Co., Ltd.
Thailand essential oil handmade soap natural extract moisturizing face wash and bath dual-use OEM customization
$ 0.75 ~ $ 1
>=100 Piece
Meo Food Co., Ltd.
Witch Hazel smoothing mud best clean clear face wash for men and women 200ml
$ 18.01 ~ $ 30.01
>=50 piec
Meo Food Co., Ltd.
100g Removal Pimple Pore Acne Treatment Sea Salt Soap Cleaner Moisturizing Goat Milk Soap Face Care Wash Basis Soap
$ 0.49 ~ $ 0.61
>=12 piec
Meo Food Co., Ltd.
OEM/ODM Private Label Skin Care Organic Honey Essential Oil Soap Face Whitening Natural Handmade Soaps for Pimple Body Lotion
$ 0.45 ~ $ 0.8
>=500 Piece
Meo Food Co., Ltd.
Customizable Hot Selling Natural Herb Soap Handmade Bath Bitter Ginseng Soap For Face Washing
$ 0.45 ~ $ 1
>=50 Piece
Meo Food Co., Ltd.
High Quality Wholesale Custom Volcanic Mud Handmade Soap For Face and Body soap private label
$ 0.68 ~ $ 0.88
>=1 Piece
Meo Food Co., Ltd.
OEM Wholesale cheap Children's cartoon Natural Botany Soap Whitening Handmade Goat Milk Soap For Cleansing Face Care wash hands
$ 0.75 ~ $ 0.89
>=1 Piece
Meo Food Co., Ltd.
OEM/Private Label Anti Bacterial Pure Organic Aloe Vera Soap for Face & Body Wash Cleaner Moisturize
$ 0.59 ~ $ 1.29
>=2000 pieces
Meo Food Co., Ltd.
Sea Salt Soap Removal Pimple Cleaner Moisturizing Goat Milk Face Wash Soap Base Skin Care
$ 0.7 ~ $ 1.19
>=20 Piece
Meo Food Co., Ltd.
Thailand essential oil handmade soap natural extract moisturizing face wash and bath dual-use OEM customization
$ 0.75 ~ $ 1
>=6 Piece
Meo Food Co., Ltd.
Korean Skin Care Tea Tree Best Face Wash for Oily Skin and Sensitive Skin
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Herbal Face Wash Gel Amino Acid Facial Cleansing Foam Lotion OEM for Men
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Skin Whitening Cleanser Natural Snail Cleansing Foam Whitening Face Wash
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
OEM Organic Oil Control Tea Tree Facial Skin Face Wash Cleanser Private Label
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Korean Natural Glutathione Skin Whitening Face Wash and Cream Facial Cleanser
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Hydrating Vitamin C Milk Baby Face Wash Facial Aloe Organic Cleansing Foam Cleanser Private Label
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Natural Effectively Remove Facial Dirt Skin Whitening Snail Cleansing Facial Foam Acne Face Wash
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Ginseng Papaya Herbal Best Anti Acne Whitening Private Label Face Wash Cleanser
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Tea Tree Glutathione Whitening Face Wash and Cream for Face Cleaning
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Facial Pore Cleanser Gentle Organic Wholesale Papaya Best Face Wash Cream for Oily Skin
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
Best Medicated Pigmentation Mens Face Wash for Oily Skin Face Cleanser
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Best Cleanser OEM Cleansing Foam Organic Tea Tree Facial Wash Private Label
$ 2.2 ~ $ 6
>=12 Piece
Meo Food Co., Ltd.
KSTimes Beauty Skin Whitening Face Fresh Cleanser Cream for Acne Treatment
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Acne Treatment Acne Face Wash Best Facial Cleanser For Men Wholesale
$ 2.5 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Japanese Organic Tea Tree Face Wash Foaming Facial Cleanser to Remove Acne and Dirt
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Japanese Medicated Acne Face Wash Foaming Facial Cleanser for Gift
$ 1.9 ~ $ 5
>=12 Piece
Meo Food Co., Ltd.
Hyaluronic Acid Ginseng Extract Face Cleanser Facial Scrub Cleansing Acne Treatment Blackhead Remover Pimples Pores Skin Care
$ 1.98 ~ $ 2.3
>=20 Piece
Meo Food Co., Ltd.
100g Beauty care supplies Deep cleaning dead sea mud soap pimple whitening soap
$ 1.1 ~ $ 1.2
>=500 Piece
Meo Food Co., Ltd.
OEM/ODM Private Label collagen 24k Gold Facial Mask for Anti Aging Anti Wrinkle Facial Treatment Pore Minimizer
$ 1.2 ~ $ 2.7
>=100 Piece
Meo Food Co., Ltd.
Cleansing whitening Hemp soap natural soap for oem
$ 2.97 ~ $ 4.5
>=2 Piece
Meo Food Co., Ltd.
The colory soap skin care soap for private label
$ 2.97 ~ $ 4.5
>=2 Piece
Meo Food Co., Ltd.
alibaba china online shopping 2019 new product private label green tea whitening cream unique natural Black facial mask
$ 2.2 ~ $ 2.7
>=100 Piece
Meo Food Co., Ltd.
Deep Cleansing whitening Hemp soap CBD soap for womens
$ 4.5
>=2 Piece
Meo Food Co., Ltd.
Private Label Handmade Organic Black Bamboo Charcoal Sanitizer Soap for Daily Cleaning Hand Soap with Customized Logo
$ 0.5 ~ $ 0.68
>=10 Piece
Meo Food Co., Ltd.
Related Searches:
cetaphilgentlefacewashbluefacewashelectricfacialcleanserfacesoapforsensitiveskinshiseidofacewashbestorganicfacewashoilofolayfacewashchemicalfreefacewashbestwaterbasedcleansermildfacewashfacewashforacneproneskintop5facewashgarnierskinactivemicellarfoamingfacewashgoodfacewashforcombinationskinbestexfoliatingfacewashbestcrueltyfreefacewashproactivdeepcleansingwashhydratingfacewashgentlefacecleanserpurposefacialcleanserbasiscleanercleanfacewashcetaphilgentlefoamingcleanserbestoilcontrolfacewashbestoilcontrolfacewashformenscetaphilfacewashpricethefaceshopcleansingoilglycolicfacewashteatreefoamingfacewasheltamdfoamingfacialcleansermarykayfacewash