Welcome to TradeChina
-
RELATED CATEGORIES:
New popular quality assurance car radio Bt navigation with LCD wireless touch screen
$ 25
>=1000 piec
Meo Bio Energy Sales Co.LTD
Single Din Detachable panel Car stereo Car DVD CD Player Compatible with DVD MP3 MP4
$ 28 ~ $ 31
>=500 Set
Meo Bio Energy Sales Co.LTD
Universal Wireless Apple MMB Carplay Dongle Wiereless Mirror-link Car DVD Player Car Video Auto Electronics
$ 75 ~ $ 115
>=2 piec
Meo Bio Energy Sales Co.LTD
Newest l Din Android 7" Unchesdual Channe DVD Player Amplifier Audio Touch Double Screen Radio Car Stereo
$ 65.8 ~ $ 69.6
>=2 Piece
Meo Bio Energy Sales Co.LTD
UPsztec 10.25 inch quad core Android 10.0 Car Radio Car DVD Player for BMW X5 E70 X6 E71(2007-2010) original CCC system
$ 55 ~ $ 325
>=2 piec
Meo Bio Energy Sales Co.LTD
9" Android 9.0 reverse camera view Car dvd player For Hyundai Elantra Avante Radio 2012 2013 with video radio mirrorring BT
$ 80 ~ $ 100
>=1 piec
Meo Bio Energy Sales Co.LTD
Newnavi car video android 10 car dvd player with reversing camera touch screen car gps navigation for Hyundai I30 2011-2013
$ 200 ~ $ 211
>=2 Set
Meo Bio Energy Sales Co.LTD
Android Bluetooth Wifi Car Radio Single Din Touch Screen Car Dvd Player With Reversing Camera For Passat
$ 69.05
>=1 Piece
Meo Bio Energy Sales Co.LTD
Single din touch screen car dvd player car radio with reversing camera,car audio radio
$ 61.5 ~ $ 104
>=500 Piece
Meo Bio Energy Sales Co.LTD
android car radio gps multimedia dvd player for hyundai ix35 with reverse camera 2din car radio navigation system hyundai tucson
$ 170 ~ $ 210
>=1 piec
Meo Bio Energy Sales Co.LTD
10.1 Inch IPS 2 Din Universal Car Radio DVD Player Intel Octa Core Rotatable Universal For Honda Kia Toyota Car Audio Video
$ 180 ~ $ 219
>=1 piec
Meo Bio Energy Sales Co.LTD
Dasaita Vivid for Toyota 4runner 2014 2015 2016 2017 2018 Android Car Stereo 10.25 inch IPS Screen Apple Carplay GPS Car Radio
$ 250 ~ $ 298
>=1 Piece
Meo Bio Energy Sales Co.LTD
9 inch android car dvd stereo player with gps navigation system for VW universal
$ 108 ~ $ 112
>=1 piec
Meo Bio Energy Sales Co.LTD
ZEST android 10 car dvd player for Brilliance H220 H230 touch screen headunits radio with gps camera
$ 179 ~ $ 189
>=1 piec
Meo Bio Energy Sales Co.LTD
Car DVD Player audio equipment/touch screen digital simulation+TV+mp3 mp4+Radio DVD Player link Rearview Camera
$ 45 ~ $ 70
>=1 Piece
Meo Bio Energy Sales Co.LTD
2 Din 10 Inch Touch Screen CD GPS Navigation Stereo Radio 8288t Solution Support Reverse Camera Car CD DVD Player
$ 65.8 ~ $ 69.6
>=2 Piece
Meo Bio Energy Sales Co.LTD
9 inch touch screen android 8.1 go 2 din car dvd player with reversing camera for honda accord
$ 43 ~ $ 48
>=1 Piece
Meo Bio Energy Sales Co.LTD
Dasaita android 10 car radio dvd player for car for Honda Civic Double DIN Car Navigation Reverse Camera 4G/5G Apple Carplay
$ 393 ~ $ 444
>=2 Piece
Meo Bio Energy Sales Co.LTD
Universal 7018B 7 inch wince car mp5 video dvd player 2 DIN with frame reversing camera mirror link steering wheel controler
$ 28 ~ $ 30
>=2 Set
Meo Bio Energy Sales Co.LTD
1001C 10" inch universal Car Android DVD player MP5 Audio GPS Stereo With Reverse Camera
$ 96 ~ $ 100
>=2 piec
Meo Bio Energy Sales Co.LTD
Podofo 2Din Android Car Radio 9.1 7" 2 Din Autoradio GPS Navigation WIFI Bluetooth FM Mirror Link + Rear Camera
$ 2.99 ~ $ 63.99
>=2 Piece
Meo Bio Energy Sales Co.LTD
Podofo 10.1'' Autoradio 2 Din Android 8.1 Car Radio Stereo 2Din HD 2.5D Tempered Glass Touch Screen Car Video WIFI GPS Bluetooth
$ 2.99 ~ $ 80.99
>=2 Piece
Meo Bio Energy Sales Co.LTD
Android 9 inch 2 Din Car Auto audio stereo Radio DVD Player GPS Receiver For VW Rear reversing Camera
$ 70 ~ $ 74
>=4 Set
Meo Bio Energy Sales Co.LTD
GPS autoraido car double 2 din android radio for opel Vauxhall Astra H Corsa Vivaro Meriva Vectra Zafira
$ 82.26 ~ $ 92.97
>=1 piec
Meo Bio Energy Sales Co.LTD
Newnavi car gps navigation 7'' touch screen radio with reverse camera wifi Android 9.0 car dvd player for Hummer H3 2006-2008
$ 314 ~ $ 326
>=1 Set
Meo Bio Energy Sales Co.LTD
Car Radio Player with DVD/SD/USB/FM/AM
$ 165 ~ $ 230
>=1 Set
Meo Bio Energy Sales Co.LTD
Best Performance 1 Din Car DVD Player with Auto Rear Viewing Function
$ 20 ~ $ 150
>=10 Piece
Meo Bio Energy Sales Co.LTD
Touch Screen Wince 6.0 Version Dual Core Double-DIN Car DVD Player With GPS Bluetooth Radio EX-TV Universal
$ 22 ~ $ 35
>=10 Piece
Meo Bio Energy Sales Co.LTD
Ownice Made In China Mercedes Benz C-W203 Car DVD Player With Reversing Camera Mercedes C Class W203 2004 - 2007 c200 C230 C240
$ 289 ~ $ 333
>=1 Set
Meo Bio Energy Sales Co.LTD
Double din car dvd vcd cd mp3 mp4 player with reversing camera for Ssangyong rexton
$ 177 ~ $ 180
>=1 Piece
Meo Bio Energy Sales Co.LTD
7 Inch Android 10.0 Long hardware Touch Screen Car Audio Player with GPS WiFi Mirror link USB
$ 63 ~ $ 66
>=2 Piece
Meo Bio Energy Sales Co.LTD
12V/ 24V 7 Inch Touch Screen Car 2 Din Stereo Video Entertainment Player with SD/ USB/ MP3/MP5/ FM/ Reversing Camera
$ 18.5 ~ $ 21
>=5 piec
Meo Bio Energy Sales Co.LTD
Car Radios With Reverse Camera And GPS System Multimedia Car DVD Player FOR KIA RIO LEFT PEPTIDE With GPS Auto Radio Audio
$ 75 ~ $ 85
>=2 piec
Meo Bio Energy Sales Co.LTD
KD-1845 Android 10 PX5 Touch Screen 4+64GB RAM/ROM New Arrival Car DVD Player for Elantra 2021
$ 259 ~ $ 283
>=2 Piece
Meo Bio Energy Sales Co.LTD
7'' car dvd player for E46/M3 1999-2006 car audio radio with bluetooth gps 3g car audio with bluetooth illumination lights
$ 200 ~ $ 500
>=1 Piece
Meo Bio Energy Sales Co.LTD
Android 10.0 Car GPS Navigation DVD Player For BMW Mini Cooper 2006-2013 With Radio 1080P Video USB SD Rearview Camera
$ 459.99
>=1 Piece
Meo Bio Energy Sales Co.LTD
Dasaita android 10 car radio dvd player for car for Honda Civic Double DIN Car Navigation Reverse Camera 4G/5G Apple Carplay
$ 393 ~ $ 444
>=2 Piece
Meo Bio Energy Sales Co.LTD
Android 10 For Opel GPS Multimedia Car Radio Video Player Navigation 7'' Astra Vectra Antara Zafira Corsa Combo Stereo DSP
$ 84.62 ~ $ 122.22
>=50 Unit
Meo Bio Energy Sales Co.LTD
7 Inch With Reversing Camera Universal Bluetooth Screen Multimedia Radio MP5 Cd Dvd Car Video Player
$ 27.3 ~ $ 31.8
>=2 Set
Meo Bio Energy Sales Co.LTD
10.1 inch Car Multimedia Player 1 Din Car Radio Bluetooth USB Reverse Camera MP5 Player Autoradio NOT Android System
$ 37.95 ~ $ 38.5
>=1 piec
Meo Bio Energy Sales Co.LTD
XinYoo Factory Best Selling Best Quality 7'' HD Touch Screen,car dvd player Mirror link and Bulit-in Bluetooth Car MP5 Player
$ 22 ~ $ 25.5
>=1 Piece
Meo Bio Energy Sales Co.LTD
Related Searches:
uemedvdplayernaviskautocardvdplayergeesoniccardvdplayerindashcardvdplayermazdadvdplayerexoradvdplayerminidvdplayerpriceheadresttvscreenspioneerdoubledindvdplayerpioneercddvdplayercaraudioinstallingdvdplayerincarvolvoxc90dvdplayerportabledvdplayerforcarbestbuy1dindvdpoweracoustikcardvdplayercardvdplayerwithscreenportabletvdvdcomboforcarportablecartvmonitorsnextbase9androidcardvdplayergpsnavigationcarseatvideoplayercaraudiodvdplayerbestcardvdplayer2018xtronsheadrestportablevideoplayerforcartouchscreenheadrestdvdplayersingledincardvdplayerdvdcaraudiobestcarheadrestdvdplayerincartvdvd