Welcome to TradeChina
-
RELATED CATEGORIES:
Mini Line Lights Bedroom Plug Bistro Lights Decor Waterproof Led String Light Cable
$ 6.5 ~ $ 8
>=100 Piece
Meo Food Co., Ltd.
C7 & C9 Christmas lights ws2811 LED pixel light strings 12V
$ 0.37 ~ $ 0.4
>=50 Piece
Meo Food Co., Ltd.
QUALITY CE waterproof hanging christmas decoration led curtain star string light
$ 4.5 ~ $ 6
>=5 pieces
Meo Food Co., Ltd.
EVERMORE LED High Quality Edison Bulb Wedding Decoration Light String
$ 3.69 ~ $ 4.99
>=10 Piece
Meo Food Co., Ltd.
10Ft 3M Cool White Copper Wire 30 Leds Waterproof Battery Christmas Tree Home Bedroom Decoration Fairy Led String Light
$ 1.04
>=1 Piece
Meo Food Co., Ltd.
Custom Size C7 E12 Base Christmas Light Spools SPT-1 Green White Wire
$ 120 ~ $ 130
>=1 rolls
Meo Food Co., Ltd.
Christmas c7 strawberry Lights Connectable String waterproof decoration mini lights string
$ 8.65 ~ $ 10.36
>=50 sets
Meo Food Co., Ltd.
Classic Faceted C7 Christmas Decorative Lights Colored 25ft 25led Roofline Light String
$ 4 ~ $ 6
>=100 Set
Meo Food Co., Ltd.
Christmas LED Light 25FT G40 Clear Globe Bulb Green Wire E12 C7 String Light
$ 1.2 ~ $ 8
>=50 Piece
Meo Food Co., Ltd.
C7 C9 Bulb Christmas String Light, Roofline Light String, Hanging Christmas Outdoor Patio String Lights E12 E14
$ 1.25 ~ $ 6.35
>=100 Meter
Meo Food Co., Ltd.
UL Approved Customized 25 Count LED Faceted C7 Light String 12FT
$ 2.19 ~ $ 2.54
>=500 pieces
Meo Food Co., Ltd.
C7 outdoor lighting string
$ 1 ~ $ 100
>=100 Roll
Meo Food Co., Ltd.
4pk 18in 4L LED Solar light string C7 stakes for Christmas yard
$ 4.03 ~ $ 6.99
>=200 Piece
Meo Food Co., Ltd.
DC12V RGB C7 C9 LED light string / Christmas tree lighting / LED string light
$ 0.72 ~ $ 1.45
>=100 Piece
Meo Food Co., Ltd.
25Ft G40 Globe String Lights with Bulbs for Indoor/Outdoor Commercial Decoration
$ 5.37 ~ $ 6.5
>=100 sets
Meo Food Co., Ltd.
Hongshun G40 Copper Wire Led Patio String Light Christmas Lights, 25LED Globe Bulb String Lights for Garden, Patios,Home Decor
$ 5.5 ~ $ 6
>=1000 Set
Meo Food Co., Ltd.
Top Sale LED String Light Christmas Outdoor Patio Ball Light String Light
$ 1 ~ $ 9.41
>=20 Set
Meo Food Co., Ltd.
Fast delivery christmas decoration led string lights c6 strawberry lights string for christmas tree
$ 5 ~ $ 13
>=10000 Piece
Meo Food Co., Ltd.
48 Foot outdoor Weatherproof flexible led Light string Hanging Sockets Perfect Patio Lights
$ 0.2
>=100 Piece
Meo Food Co., Ltd.
Hot sale E12/C7 E12 led solar string light for decorative outdoor christmas
$ 15.38 ~ $ 16.38
>=200 Set
Meo Food Co., Ltd.
c7 christmas crystal edison patio fairy halloween curtain bulbs neon warm white led outdoor curtain string lights rgb lighting
$ 1.88 ~ $ 7.99
>=40 pieces
Meo Food Co., Ltd.
custom Nickel all purpose magnetic shingle tab window mini clips adhesive c7 c9 c led christmas string light deck tree clip
$ 0.18 ~ $ 0.2
>=1 Piece
Meo Food Co., Ltd.
Holiday Light C7 C9 LED RGB Bulb Led Christmas String Light Fairy Light
$ 3.4 ~ $ 3.8
>=100 Set
Meo Food Co., Ltd.
Manufacturer best selling 25FT G40 E12 global bulbs string light
$ 6.49 ~ $ 8.99
>=160 sets
Meo Food Co., Ltd.
48FT S14 G40 Plastic Solar Outdoor Christmas Holiday Lighting Garden Powered String Lights With C6 C7 C9 E27 Bulbs Led Edison
$ 16.75 ~ $ 17.65
>=2 Piece
Meo Food Co., Ltd.
Christmas led street light motif outdoor snowman
$ -
>=1 Piece
Meo Food Co., Ltd.
25FT String Lights With 25pcs Clear Bulb G40 Black Wire Decorative Garland
$ 6 ~ $ 7.5
>=10 Set
Meo Food Co., Ltd.
Garden light edison Bulb LED C7 strings decoration lights for events
$ 0.19
>=500 Piece
Meo Food Co., Ltd.
UL C7 E12 PVC Green/Black Wire Light Spool Decoration String Light Spool
$ 85 ~ $ 150
>=100 Roll
Meo Food Co., Ltd.
Sun Warm white Frosted C7 rgb led pink e12 replacement string retro light bulbs cover
$ 0.36 ~ $ 0.42
>=1000 sets
Meo Food Co., Ltd.
User-friendly design Best supplier string led light
$ 5.78
>=500 Set
Meo Food Co., Ltd.
Related Searches:
usbstringlightseasterstringlightssolarbulbstringlightsledxmastreelightsledchristmasstringlightsdisneystringlightsdimmablestringlightscolorchangingstringlightswithremotefestoonpartylightsbestpatiolightslargebulbstringlightsfairylightsinemptywinebottlesfairylightsoverbedledricelightssilverwirelightsgeenergysmartchristmaslightslongstringlightstwinklingchristmastreelightsfairylightlampledtwinklelightsincandescentstringlightsbatteryledchristmaslightsfeitstringlightscostcochristmasstringchristmastreefairylightschristmaslightstrandstwinklestringlightspinkledchristmaslightsoutdoorpatiolightsledsolarstringlightscanada