Welcome to TradeChina
-
RELATED CATEGORIES:
Frozen Cooked Cultivatedshitake Dehydrated Dried Button Mushroom
$ 5 ~ $ 6
>=12 Pack
Meo Auto Parts Co.LTD
Nordic postmodern minimalist designer light luxury mushroom table lamp creative personality bedroom bedside lamps
$ 51.88 ~ $ 62.69
>=2 Piece
Meo Food Co., Ltd.
custom Oak 1/2" Wood Mushroom Button wooden plugs for Screw Hole Covers
$ 0.32 ~ $ 0.42
>=1000 Piece
Meo Food Co., Ltd.
2019 Whole Year Round Supplied Cultivated White Shimeji Mushroom Button Mushroom Spawn
$ 2.7
>=3000 Kilogram
Meo Auto Parts Co.LTD
2020 new mini led mushroom projector night light sleep led night lamp for kids
$ 6 ~ $ 6.3
>=36 Piece
Meo Food Co., Ltd.
Romantic Decoration Rechargeable Mushroom Kids Child Night Light Small Table Star Projector Lamps
$ 1.95 ~ $ 2.5
>=50 Piece
Meo Food Co., Ltd.
Mushroom for decoration side view 10*22mm purely silicone Neon with 24v 120 leds SMD 2835 ip67 outdoor neon led strip light
$ 5.5 ~ $ 8
>=5 Meter
Meo Food Co., Ltd.
electric steam sterilizer and dryer mushroom sterilizer machine pen industrial air hair sterilizer intelligent disinfection
$ 9.9 ~ $ 10.9
>=2 Piece
Meo Food Co., Ltd.
Hot-selling LED silk rose flower lamp romantic scene lamp for decoration Led lotus leaf mushroom Nightlight LED decorative lamp
$ 0.3 ~ $ 0.8
>=100 Set
Meo Food Co., Ltd.
Mini Cartoon Shape Night Led Lamp energy saving Light Children Gift Kids baby Bedroom Mushroom Duck Night light
$ 0.26 ~ $ 0.37
>=240 piec
Meo Food Co., Ltd.
Universe Starry Sky Night Light Logo Mushroom Starlight Projection Lamp
$ 3.5 ~ $ 5.9
>=36 Piece
Meo Food Co., Ltd.
disinfecting roll ozone 220 desinfector mushroom substrate sterilizer ricoh uv ink uv light 320nm wavelength
$ 8.9 ~ $ 12.9
>=2 piec
Meo Food Co., Ltd.
BOOK LIGHT WITH CLIP book light clip light
$ 0.51 ~ $ 5.01
>=2 Piece
Meo Food Co., Ltd.
9w 10w outdoor landscape low voltage decorative waterproof fixtures led fence pillar lights
$ 16 ~ $ 280
>=1 Piece
Meo Food Co., Ltd.
2021 Hot Sell High Quality Baby Sleep Soother Sky Night Light Projector with music for kids
$ 4.85 ~ $ 6.35
>=48 Piece
Meo Food Co., Ltd.
sterilizer price uv light disinfection uvc led e27 uvc light fixture germical lamp virus scanning anti virus lamp stick
$ 9.9 ~ $ 12.9
>=10 piec
Meo Food Co., Ltd.
Flat head neon top view 12*12mm purely silicone high quality with 24V SMD 2835 120leds fwaterproof ip67 flex neon led strip ligh
$ 4.77 ~ $ 6.89
>=5 Meter
Meo Food Co., Ltd.
Top view 15*16mm 180 degree wider beam angle purely silicone Neon with 24v SMD 2835 120leds ip67 waterproof neon led strip li
$ 3.15 ~ $ 4.5
>=5 Meter
Meo Food Co., Ltd.
Factory Supply Portable uv germicidal sterilization lamp ultraviolet portable uv light
$ 8.5 ~ $ 10
>=1 Piece
Meo Food Co., Ltd.
Side viewing 6*13mm for decoration 100% silicone good price with 24v SMD 2835 120leds ip67 neon led strip light
$ 3.15 ~ $ 4.5
>=5 Meter
Meo Food Co., Ltd.
Ocean Indoor Colorful Led Sky Starry Star Kids Children Night Lights Projector lamp for Children love
$ 7.35
>=48 Piece
Meo Food Co., Ltd.
Related Searches:
icecreammakingprojectvegetableoilprocessingplantmushroomprojectcosthoneyprocessingplantpdfdairyproductsprojectbabyfoodjarcraftdiycandycraftsdairymilkprojectdairymilkprojectpdfmilkfarmingprojectfooddiyprojectscandyprojectsoybeanoilmillprojectcostvegetableprojectsmallscalemushroomfarmingpomegranateprocessingplantcostsoybeanoilrefinerymushroomfarmingprojectcostcultivationofoystermushroomprojectchocolatemanufacturingplantcostcakeprojectssolarovencookiesprojectondairymilksoybeanmilkprojectdairyplantprojectdowndraftsolardehydratormilkprojectcandycraftsforkidssoyamilkprojectpdfricebranoilmanufacturingplantcost