Welcome to TradeChina
-
RELATED CATEGORIES:
8 Oz Leak Proof 18/8 Stainless Steel Pocket Hip Flask for drinking
$ 1.5 ~ $ 3.5
>=25 Piece
Meo Food Co., Ltd.
Portable outdoor the best sport insulated wide mouth stainless steel water bottle traditional thermal flask
$ 2.98 ~ $ 3.15
>=500 Piece
Meo Food Co., Ltd.
Japanese Coffee And Hot Drinks 500ml Fashion 304 Stainless Steel Vacuum Flask
$ 18 ~ $ 18.54
>=1 Piece
Meo Food Co., Ltd.
Custom Logo Stainless Steel Double Wall Kids Flask Thermos Vacuum Water Bottle With Free Sample
$ 1.8 ~ $ 3
>=500 Piece
Meo Food Co., Ltd.
High Quality Health Care Stainless Steel Water Bottle 450ML Drink Promotion Alkaline Best Hydrogen PH Rich Flask
$ 5 ~ $ 7.8
>=10 Piece
Meo Food Co., Ltd.
2021 Best Thermo Flask bottle Stainless Steel Vacuum With Vacuum Flasks Thermoses Stainless Steel Drinking Cup
$ 3.8 ~ $ 4.4
>=10 Piece
Meo Food Co., Ltd.
2021 Best Selling NEW Design Sport Bottle with straw Double wall vacuum Drink Flask with Loop Insulated
$ 3.18 ~ $ 20
>=2 Piece
Meo Food Co., Ltd.
Customized Stainless Steel Vacuum Flask Water Bottle Insulated Sports Bottle
$ 3.7 ~ $ 4.4
>=100 Piece
Meo Food Co., Ltd.
22 oz 30 oz best selling items 2019 thermos stainless steel tumbler flask for drinking
$ 3.25 ~ $ 3.9
>=1000 Piece
Meo Food Co., Ltd.
Best selling 40 oz Wide mouth Vacuum Flask Insulated Stainless Steel Coffee Bottle with powder coating
$ 2.28 ~ $ 2.34
>=50 Piece
Meo Food Co., Ltd.
2020 High Quality Double Wall Insulated Termos Vacuum Flask, Custom Color Protein Stainless Steel Sports Shaker Water Bottle
$ 3.59 ~ $ 3.79
>=2000 Piece
Meo Food Co., Ltd.
New Products 2020 best seller stainless steel thermos powder coated water bottels flask 500ml/750ML/1000ML
$ 2.8 ~ $ 3.5
>=10 Piece
Meo Food Co., Ltd.
Best Selling Food Grade Double wall Water bottle insulated stainless flask sports thermos
$ 2.58 ~ $ 9.9
>=2 Piece
Meo Food Co., Ltd.
Best Selling 500Ml Food Grade Business Thermos Flasks 316 Stainless Steel Vacuum Insulated Water Bottle
$ 6.4 ~ $ 7.8
>=100 Piece
Meo Food Co., Ltd.
2021Amazon best sellers double wall stainless steel metal water bottle vacuum flask insulated drink bottles with custom logo
$ 2.4 ~ $ 2.5
>=500 Piece
Meo Food Co., Ltd.
2020 Best Selling 1L thermos water bottle with two cups Stainless Steel Flask for Hot Drinks Vacuum Insulated food flask
$ 3.85
>=1000 Piece
Meo Food Co., Ltd.
amazon top seller 2019 ss drink bottle water bottle sport stainless steel vacuum flask 32oz
$ 3.05 ~ $ 3.65
>=100 Piece
Meo Food Co., Ltd.
Insulated 350ml Customized COOL Water Bottle Wholesales Best selling Sports Bottle with normal color painting
$ 2.8 ~ $ 3.4
>=2 Piece
Meo Food Co., Ltd.
bpa free custom logo hot double walled stainless steel metal designed insulated flask vacuum thermos drink water bottle
$ 2.51 ~ $ 2.82
>=100 piec
Meo Food Co., Ltd.
Best Vacuum Insulated Stainless Steel Water Bottle with LED display
$ 1.7 ~ $ 1.86
>=500 boxe
Meo Food Co., Ltd.
The best and cheapest custom printed double wall stainless steel insulated thermal vacuum flask
$ 2.88 ~ $ 3.68
>=500 Piece
Meo Food Co., Ltd.
Best Straw Lid Insulated Water Bottle Unique Stainless Steel Water Bottle
$ 1.83 ~ $ 1.97
>=300 Piece
Meo Food Co., Ltd.
metal customized color winox thermos flask
$ 3.2 ~ $ 4.5
>=10 Piece
Meo Food Co., Ltd.
Amanzon best seller 1 gallon jug 128 oz growler stainless steel big water bottle jug gallon with hand lid
$ 7 ~ $ 10
>=2 Piece
Meo Food Co., Ltd.
16oz best selling thermos flask manufacturers
$ 2 ~ $ 3.2
>=3000 Piece
Meo Food Co., Ltd.
Best Selling Products Double Wall Slim Thin Stainless Steel Vacuum Insulated Flask Thermos Water Bottle
$ 2.49 ~ $ 2.99
>=1 Piece
Meo Food Co., Ltd.
designed hot cold 32 oz stainless steel wide mouth flask water bottle eco powder coated vacuum insulated flask thermos bottle
$ 2.2 ~ $ 3.6
>=100 Piece
Meo Food Co., Ltd.
2020 Best Seller supply directly cool water insulated bottle 18/8 stainless steel water bottle standard mouth
$ 2.45 ~ $ 9.9
>=1 Piece
Meo Food Co., Ltd.
FUCHARM Best Selling Vaccum Sports Bottle Low Price Fashionable Cola Insulated Water Bottle
$ 2.98 ~ $ 4
>=1 Piece
Meo Food Co., Ltd.
SANMI Best selling sports water bottle hydro vacuum 1 litre cup flask stainless steel thermos 18oz 32oz 40oz hot cold water
$ 5.8 ~ $ 7
>=2 Piece
Meo Food Co., Ltd.
Best Selling Double Wall Thermal Large Water Bottle Flask 64OZ Insulated Beer Growler with Carry Case
$ 6.5 ~ $ 7.5
>=500 Piece
Meo Food Co., Ltd.
18/8 stainless steel double wall food grade thermos keep cold and hot 24hours
$ 2.5 ~ $ 3.1
>=1000 Piece
Meo Food Co., Ltd.
Keep Drink Hot Longer Thermos
$ 2.79 ~ $ 4.57
>=100 piec
Meo Food Co., Ltd.
SEDEX BSCI 350ml 20oz Stainless Steel 2 Handle Mug Best Travel Tumbler Coffee Thermos
$ 4.39 ~ $ 6.59
>=2 Piece
Meo Food Co., Ltd.
Best selling double wall stainless steel bullet thermos flasks with handle
$ 4 ~ $ 5.16
>=1000 Piece
Meo Food Co., Ltd.
Amazon Hot Sale Products High Quality Eco-friendly BPA-free Stainless Insulated Vacuum Flask Cup Water Bottle Coffee Cup
$ 1.9 ~ $ 2.1
>=20 Piece
Meo Food Co., Ltd.
18oz 500ml High quality best seller double wall eco-friendly stainless steel water bottle vacuum drink products thermal flask
$ 3.9 ~ $ 4.1
>=100 Piece
Meo Food Co., Ltd.
Best sale wholesale durable portable double wall thermoses bottle customize stainless steel insulated vacuum flasks thermos
$ 2.1 ~ $ 2.9
>=2 Piece
Meo Food Co., Ltd.
Related Searches:
sterlingsilverflaskssmallwhiskeyflaskgroomhipflask3ozhipflask16ozhipflaskhipflaskwithbuiltincupredhipflaskhipflasktartancircularhipflaskwhiskyflasknearmedisposablehipflaskstainlesssteelalcoholflaskhipflaskonlinebestwhiskeyflaskssmalldrinkingflasksmallpocketflaskpantonehipflaskwhiskysteelflaskbluehipflasktedbakerdrinkingflaskbestwhiskeyforflaskpewterpocketflaskbestwhiskeyflaskglasshipflaskwithleathercaseengravedleatherhipflaskblackleatherhipflaskoldhipflask3ozflasktravelhipflaskahipflask