Welcome to TradeChina
-
crushing thoroughly suitable for all kinds of food residue kitchen food waste processor
$ 100 ~ $ 110
>=1 Set
Meo Advertising Co.LTD
eco friendly Wholesale natural Sustainable Zero Waste reusable wax food wrap fresh keeping wrap
$ 3.59 ~ $ 4.78
>=1 Set
Meo Auto Parts Co.LTD
Hot Sale Customized Color and Size Food Wrap Flexible Packaging Roll Film For Chips for Packaging Film
$ 0.8 ~ $ 1.25
>=1 Ton
Meo household Co.LTD
Food Storage Beeswax Reusable Wrap,Beeswax Food Wrap
$ 2.5 ~ $ 4.5
>=100 bag
Meo Auto Parts Co.LTD
Texupday Zero Waste Beeswax Food Storage Wrap Organic Cotton Cloth Reusable Wrap Bee Wax Wrap
$ 2.5 ~ $ 4.4
>=100 piec
Meo Auto Parts Co.LTD
100% Biodegradable Organic Cotton Natural Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Food Paper Set
$ 3.7 ~ $ 4
>=5 Set
Meo Auto Parts Co.LTD
Zero Waste Kitchen 3pack 100% organic cotton reusable wrap beeswax food wraps
$ 1.25 ~ $ 5.5
>=10 pieces
Meo Auto Parts Co.LTD
Washable Reusable Beeswax Food Wrap Paper Sheet Bee Wax Natural Organic Food Wraps
$ 0.8 ~ $ 1.2
>=100 piec
Meo Auto Parts Co.LTD
Reusable Wax Food Wraps Eco Friendly Sustainable Zero Waste cover for Food to Keep Fresh Beeswax Wrap
$ 2.39 ~ $ 3.55
>=300 set
Meo Auto Parts Co.LTD
3 Pack Sustainable Zero Waste Beeswax Food Wrap
$ 4.99
>=1 Piece
Meo Auto Parts Co.LTD
Beeswax food wrap Factory new product Promotion LFGB GOTS zero waste Eco friendly beeswax reusable beeswax wrap
$ 2.5 ~ $ 4.2
>=100 sets
Meo Auto Parts Co.LTD
Zero Waste Plastic Free Non Toxic Sustainble Organic Reusable Food Beeswax Wrap
$ 2.99 ~ $ 3.5
>=50 Set
Meo Auto Parts Co.LTD
Fabric Zero Waste Beeswax Wraps Food Paper Clothing
$ 2.5 ~ $ 5.5
>=100 sets
Meo Auto Parts Co.LTD
Zero Waste Reusable Beeswax Food Wrap, Eco Friendly, Organic Food Storage Wrappers Cling Sandwich
$ 3.8 ~ $ 4.5
>=1 piec
Meo Auto Parts Co.LTD
Sopurrrdy Zero Waste Kitchen 3pack 100% organic cotton reusable wrap beeswax food wraps
$ 2.45 ~ $ 4.45
>=100 Set
Meo Auto Parts Co.LTD
Zero waste plastic Free food storage cover Sustainable kitchen reusable wrapper roll custom printed bread bag Beeswax Food Wrap
$ 2.68 ~ $ 3.88
>=10 Set
Meo Auto Parts Co.LTD
Organic Eco friendly zero waste sustainable Food storage wraps Soywax Vegan Wraps
$ 2.7 ~ $ 3.8
>=100 Set
Meo Auto Parts Co.LTD
yellow beeswax zero waste produce bags organic healthy safe bees wax food wrap
$ 1.5 ~ $ 3.9
>=100 Piece
Meo Auto Parts Co.LTD
Reusable Wax Food Wraps Eco Friendly Sustainable Zero Waste cover for Food to Keep Fresh Beeswax Wrap
$ 2.5 ~ $ 3.5
>=100 Set
Meo Auto Parts Co.LTD
Alternative Plastic Wrap Save Money Amazon FDA LFGB Reusable Beeswax Food Wrap Zero Waste Protect Turtles
$ 4 ~ $ 4.2
>=20 Bag(s)
Meo Auto Parts Co.LTD
Food Grade Zero Waste Kitchen 6 Pack Sets Beeswax Bread Wrap
$ 3.8 ~ $ 5
>=10 sets
Meo Auto Parts Co.LTD
GOTS certified organic cotton high quality reusable zero waste beeswax food wrap
$ 7.9 ~ $ 8.3
>=100 sets
Meo Food Co., Ltd.
Zero Waste Eco Friendly Food Wrap Beeswax bags Reusable Natural Cotton Beeswax Food Storage bags
$ 2.5 ~ $ 4.5
>=100 pieces
Meo Auto Parts Co.LTD
Top Goods 100% Organic Eco-Friendly Zero Waste Available Stocks Plain Beeswax Wrap Set
$ 3.09 ~ $ 4.67
>=50 Set
Meo Auto Parts Co.LTD
Bulk organic beeswax food additives / raw pure yellow bee wax wrap zero waste
$ 5.9 ~ $ 8.9
>=1 Kilogram
Meo Auto Parts Co.LTD
Organic Beeswax Food Wraps 13*39 Inch Beeswax Sustainable Food Storage Reusable Zero Waste Food Wrap Roll
$ 4.1 ~ $ 4.35
>=2 sets
Meo Auto Parts Co.LTD
Sandwich Beeswax Food Wraps Natural Storage Zero Waste Cheese and Washable Bowl Cover
$ 0.89 ~ $ 0.99
>=100 pieces
Meo Auto Parts Co.LTD
GOTS Water Proof organic cotton eco friendly bee wax food wrap
$ 2.5 ~ $ 3.8
>=100 Set
Meo Auto Parts Co.LTD
Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Paper Set Natural 100 Biodegradable Organic Cotton Bag OEM Customized
$ 4.77 ~ $ 6.2
>=30 rolls
Meo Auto Parts Co.LTD
Washable Reusable Food Storage Alternative Beeswax Food Wraps
$ 5.49 ~ $ 5.99
>=100 sets
Meo Auto Parts Co.LTD
3Pcs/set LFGB Food Grade Sandwich Washable Reusable Organic Cotton Leaf Beeswax Food Paper Wraps
$ 2.98 ~ $ 3.98
>=1 Set
Meo Auto Parts Co.LTD
Eco Friendly 100% Organic Cotton food grade kitchen Beeswax Food Wrap replacement
$ 3.6 ~ $ 4.8
>=100 Set
Meo Auto Parts Co.LTD
Sandwich Lunch bag Amazon hot Selling Biodegradable Natural Organic Cotton Fabric Beeswax reusable Food bag
$ 2.5 ~ $ 3.3
>=100 sets
Meo Food Co., Ltd.
100% Biodegradable Organic Cotton Natural Eco Zero Waste Product Beeswax Wraps Food Wrap Bees Wax Paper Set
$ 3.5 ~ $ 5
>=100 Bag(s)
Meo Auto Parts Co.LTD
Custom Eco-Friendly Sustainable Biodegradable Organic Cotton Reusable Beeswax Paper Beeswax Food Wraps
$ 3.59 ~ $ 5.12
>=100 sets
Meo Auto Parts Co.LTD
Sustainable Eco Friendly Reusable Beeswax food wrap Storage Paper
$ 2.32 ~ $ 2.99
>=10 Piece
Meo Auto Parts Co.LTD
LFGB Zero-Waste Reusable Beeswax Wrap Eco Friendly Snack Fruit Sandwich Food Wax Wraps
$ 3.4 ~ $ 4.8
>=2 sets
Meo Auto Parts Co.LTD
Amazon Best Selling Sustainable Biodegradable Reusable Natural Organic Cotton Fabric Beeswax Food Wraps for Sandwich Lunch Pack
$ 3.9 ~ $ 4.9
>=100 pieces
Meo Auto Parts Co.LTD
Eco friendly beeswax reusable food wraps food storage sustainable organic sandwich bags beeswax wrap
$ 2.19 ~ $ 3.19
>=100 pieces
Meo Auto Parts Co.LTD
Sustainable Reusable Custom Eco Friendly Organic Bees Wax Wrap Roll Storage Beeswax Food Wrap
$ 1 ~ $ 4
>=200 Piece
Meo household Co.LTD
Custom Beeswax Food Wrap Roll Paper
$ 5.58 ~ $ 6.46
>=100 rolls
Meo Auto Parts Co.LTD
Certified Zero Waste Food Wrap Beeswax bags Eco Friendly Reusable natural Cotton Beeswax Food Storage bags
$ 6.06 ~ $ 7.02
>=15 pieces
Meo Auto Parts Co.LTD
Related Searches:
freshfoodwrapperforatedclingfilmrollgladpressnseal70sqftfabricfoodwrapclingfilmwithslidecutterwaxpaperclingwrappvcmeatfilmnewsaranwrapfoodwrapcutterfoodplasticfilmgladwrappressnsealcoloredsaranwrapnonbeeswaxfoodwrapsaranwraplargerollsaranwrapinmicrowaveplasticfilmfoodsaranwrapbigrollecofoodwrapdiywaxedcottonfoodwraptransparentplasticforwrappingfoodplastikwrapperpvcfoodwrapfilmstretchtiteplasticwrapplasticclingwrapecofriendlyreusablefoodwrapfoodwrappedinplasticclingwrappriceclingwrapsupplierclingfilmcutterplantbasedfoodwrap