Welcome to TradeChina
-
Japan Oribe High quality elegant tableware set dinnerware ceramic
$ 6.36 ~ $ 21.18
>=1 Piece
Meo Food Co., Ltd.
Environment-friendly bamboo fiber dinnerware dinner dining set online
$ 3.69 ~ $ 3.9
>=10 Set
Meo Food Co., Ltd.
Garden kitchen tabletop dinnerware beech organic bamboo chopping board
$ 120
>=1 piec
Meo Food Co., Ltd.
Christmas Fancy Ceramic Luxury Dinnerware Sets
$ 3.75 ~ $ 4.96
>=500 piec
Meo Food Co., Ltd.
16 pieces set Wholesale China Dinnerware Sets Ceramic For Steak Salad Coffee Tea Milk
$ 22.36 ~ $ 25.89
>=1200 piec
Meo Food Co., Ltd.
2019 New Design Very Nice Bone china Dinner Set Ceramic<
$ 0.36 ~ $ 1.09
>=100 piec
Meo Food Co., Ltd.
Very popular flower decal design melamine dinnerware 16pcs square shape bowls and plates set for restaurant dinner set
$ 0.2 ~ $ 0.99
>=3000 Set
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Plates Restaurant Vintage Glaze Ceramic Ware Item White Embossed Porcelain Dinner Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
Very cheap royal high quality porcelain dinner set
$ 5.5 ~ $ 8.4
>=1000 Set
Meo Food Co., Ltd.
Creative eco friendly dinner nirdic style tableware Love sets
$ 3.19
>=1 Set
Meo Food Co., Ltd.
Very nice bone china dinner set ceramic tableware dinner sets
$ 72 ~ $ 94
>=10 Set
Meo Food Co., Ltd.
wholesale nirdic style dinnerware sets ceramic dinner sets porcelain tableware sets
$ 50 ~ $ 61
>=2 piec
Meo Food Co., Ltd.
Hot style | online travel, dinner, business travel portable | environmental friendly bamboo tableware set
$ 1.6 ~ $ 2
>=2000 Set
Meo Food Co., Ltd.
Very Hard Unbreakable Quality stoneware dinner set with Plates set ceramic tableware
$ 36 ~ $ 39
>=500 piec
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Glazing Ware Hotel Set Ceramic Stoneware Dinner Sets
$ 6 ~ $ 8.5
>=500 Set
Meo Food Co., Ltd.
Nordic hand-painted gold-painted 2020 good price dinner ceramic plates dinnerware tableware set
$ 1.5 ~ $ 6.5
>=1 Set
Meo Food Co., Ltd.
New fashion Earth Whisper Jade White set 18.5cm Marble dinner plate
$ 71.02
>=100 piec
Meo Food Co., Ltd.
Top sale mixed abs handle 6 serrated edge stainless steak knife set laguiole cutlery knives set
$ 1.8 ~ $ 5.8
>=6 piec
Meo Food Co., Ltd.
Very cheap outdoor patio table and chairs dinner table set
$ 30 ~ $ 200
>=1 Carton(s)
Meo Food Co., Ltd.
Aluminum frame Pagoda marquee tent for outdoors dinner event
$ 45 ~ $ 55
>=25 square meter
Meo Textile Clothing Co.LTD
Very Practical Indoor Sports Table Tennis Table 18mm Carry Ping-Pong Paddle Ball Pocket With Four Big Wheels
$ 57 ~ $ 155
>=100 piec
Homelife
Wholesale high quality cheap heart shaped round dinnerware dinner microwave ceramic christmas bowls
$ 0.35 ~ $ 1
>=5000 Piece
Meo Food Co., Ltd.
Jacquard 100 % Cotton Kitchen Tea Towel Dinner Napkin Cloth
$ 0.65 ~ $ 1.3
>=500 piec
Meo Food Co., Ltd.
plastic injection mold making plastic dinner sets mold making
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Customized very good quality cheap especial amazing XMAS series ceramic mugs
$ 0.3 ~ $ 0.6
>=500 piec
Meo Food Co., Ltd.
Factory Direct Sales Of European-style Bone China Western Tableware 8-piece Luxury Versase Ceramic Dinner Plate Set
$ 24.31 ~ $ 37.99
>=2 Set
Meo Food Co., Ltd.
Set of 6 Laguiole steak knives ABS in assorted colors handles laguiole cutlery set
$ 1.8 ~ $ 5.8
>=6 piec
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Dinner Plates Sets Serving Bowls White Porcelain Dinnerware
$ 7.8 ~ $ 7.9
>=500 Set
Meo Food Co., Ltd.
Japanese Dancing Sakura Series Qualitier Ceramic Dinner Crocery Set Tableware
$ 38 ~ $ 50
>=1 Set
Meo Food Co., Ltd.
2020 new fashion Earth Whisper Jade White set 18.5cm Marble dinner plate
$ 106.9
>=2 Piece
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Natural Tableware Porcelain Ceramic Embossed Dinnerware Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
Factory wholesale european non stick coated cookware dinner set ceramic porcelain
$ 48 ~ $ 75
>=1 Piece
Meo Food Co., Ltd.
Silent Forest hand painted Wood Fired White Deep Vintage Ceramic White 20cm Ceramic dinner plate
$ 9.67
>=500 piec
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Custom Printed Plates Fine Bone China Porcelain Ceramic Embossed Dinnerware Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
Wholesale High Quality Nirdic Style Ceramic Bowl Modern Dinner Set Tableware
$ 2.5
>=1 piec
Meo Food Co., Ltd.
Silent Forest Wood Fired White Deep Plate Vintage Ceramic White Deep Plate set 20cm Ceramic dinner plate
$ 16
>=1 Piece
Meo Food Co., Ltd.
WAGA Earth Whisper Direct wholesale printed white Rose Peddle dishes ceramic plate for kitchen set dinner
$ 11.02
>=100 piec
Meo Food Co., Ltd.
Nordic minimalist underglaze color plate kitchen dinner dishes set porcelain
$ 0.5 ~ $ 4.2
>=1 Carton(s)
Meo Food Co., Ltd.
Hot selling black Earth Whisper Dark Crystal 18.5cm Stone Marble dinner plate
$ 106.9
>=2 Piece
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Cheap White Dinning Plate Dishwasher Safe Charger Plate Ceramic Embossed Dinnerware Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
China factory colorful porcelain dishes set WAGA Earth Whisper Sapphire Crystal 25.5cm ceramic dinner Plate
$ 43
>=1 Piece
Meo Food Co., Ltd.
Very Hard Unbreakable Quality High Quality Porcelain Tableware China Ceramic Embossed Dinnerware Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
European-style Phnom Penh Pink Marble Ceramic Porcelain Dish Set Dinner Dinnerware Plates
$ 0.5 ~ $ 5.44
>=1 Piece
Meo Food Co., Ltd.
Best design motif Earth Whisper set Dark Crystal 31cm Marble dinner Plate
$ 167
>=1 Piece
Meo Food Co., Ltd.
Very Hard Unbreakable Quality New Bone China Ceramic White Porcelain Embossed Dinnerware Set
$ 7.8 ~ $ 8.25
>=500 piec
Meo Food Co., Ltd.
Silent Forest Wood Fired Wholesale 25cm olive green Deep kitchen dinnerware ceramic dinner plates
$ 18.4
>=1 Piece
Meo Food Co., Ltd.
Very Hard Unbreakable Quality Ceramic Breakfast China Handmade Porcelain Dinner Dinnerware Set
$ 2.88 ~ $ 6.55
>=100 Piece
Meo Food Co., Ltd.
Silent Forest Wood Fired Ceramic Olive Green Deep Plate New production dishes dinner creative ceramic plate
$ 16
>=1 Piece
Meo Food Co., Ltd.
Gift Bowl Set Wholesale Japanese Style Home Dinner Rice Bowl Ceramic Plates Sets Dinnerware
$ 2.8 ~ $ 12.3
>=1 Carton(s)
Meo Food Co., Ltd.
Popular handmade dishes set porcelain WAGA Earth Whisper Purple Branches 20cm ceramic dinner plates
$ 33
>=1 Piece
Meo Food Co., Ltd.
Related Searches:
reddishessetheartdinnerseteverydaywhitedishestealdinnersetcorelleprovincialblueplasticdinnerwaresetsmicrowavesafeplatesetsalediscountdinnerwaresetssaltandpepperplatestargetdinnersets2018corellepatternscolorfuldinnerplatespinkdinnerwaresetorangedinnerwareflamingodinnersetikeaplatesetjapanesedinnerwaresetmelamineplatesandbowlsamazondishsetsmelamineplatesamazondinnersetunder500everydaydishesantiquedinnerwaresetsmarbledishsetcorellecrockerywhitedishsetmelamineplatesmicrowaveformaldinnerwarestonewaredishesfancydinnerset