Welcome to TradeChina
-
RELATED CATEGORIES:
Hot sale self-service automatic drinking pure water vending machine
$ -
>=100 piec
Meo Textile Clothing Co.LTD
Ro drinking water vending machine / drinking water filter system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
BGB18 Vending Machines - Bouncy Balls Gumballs Mechanical Vending Machines
$ 152.08 ~ $ 160.3
>=50 Piece
Meo Textile Clothing Co.LTD
Hot Sale Multi-functional Mini Size Mask Vending Machine
$ 198 ~ $ 218
>=1 piec
Meo Textile Clothing Co.LTD
Hot Sale Frozen Snack and Drink combo Vending Machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic laundry shop drink vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Face.mask vending machine dust mask 2019 new with coin acceptor
$ 950
>=1 Set
Meo Textile Clothing Co.LTD
factory direct sale electronic coin operate souvenir prize machine for sales
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
new desktop coin operated commercial hot&cold coffee vending machine for sale
$ 460
>=1 Set
Meo Textile Clothing Co.LTD
hot sale automatic snack food sale machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
on sale good quality 6 bottles cups Vending Machine Dispenser for Wine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
multifunctional outdoor mobile fast food snack vending trailer truck Van for pizza drink
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
New Product Custom Made Vending Machine Business Coins Paper Money Ic Id Cards Juice Milk Ice Drinks Water Vending
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China mini candy vending machine,vending machine for candy
$ 90 ~ $ 250
>=1 Piece
Meo Textile Clothing Co.LTD
Coffee Robot Vending Machine Manufacturer Max Titanium Hot Power Plate Sales Touch Panel
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN OEM&ODM custom made vending machine self service vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
XY Heated Device 50 Boxes Lunch Box Fast Food Automatic Locker Pizza Vending Machine For Sale
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Electronics Touch Screen Cosmetics Hair Perfume Lipstick Vending Machine For Sale
$ 857
>=1 Set
Meo Textile Clothing Co.LTD
ZG OEM/ODM automatic soft ice cream vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Afen china vending machine manufacturer convenient store vending machines for food and drinks snacks
$ -
>=1 Set
Meo Textile Clothing Co.LTD
GUMBALL/CANDY VENDING MACHINE VENDING MACHINE FOR SALES
$ 47
>=10 Piece
Meo Textile Clothing Co.LTD
Cheap Price Ice Coffee Bean Vending Machine For Sale LE308D
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Price Outdoor Ice Vending Machine Design For Sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Custom made Vending machine for protein necta snack
$ -
>=1 piec
Meo Textile Clothing Co.LTD
custom built vending machine for sale sushi and warm food
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2018 new flower vending machine for sale
$ -
>=8 piec
Meo Textile Clothing Co.LTD
2019 Mini Vending Machine For Sanitary Napkin Pad Tampon Towel Dispenser
$ 210 ~ $ 450
>=1 Set
Meo Textile Clothing Co.LTD
new business ideas vending machine self cheap automatic vending machine/popcorn vending machine/vending machines for sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
24 hour shop office club school factory employee member card IC, ID Card top up vending machine with management system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
3 hot ice tea drinks coin operated mini coffee vending machine for sale
$ 220 ~ $ 320
>=1 piec
Meo Textile Clothing Co.LTD
Modern Smart Touch Screen Lucky Bags Automatic Vending Machine For Sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Coin operated fresh atm dispenser milk vending machine for sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic digital mini vending machine for PPE
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Wholesale Self-service Auto Face Mask Vending Machine Dispenser Surgical Mask Vending Machine
$ 198
>=10 piec
Meo Textile Clothing Co.LTD
SNBC BVM-RI211Commercial Machine Vending For Sale Snack And Drinks Soda Cotton Candy Cup Noodle Vending Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
24H self-service supermarket ice vending machine water for sale
$ -
>=3 piec
Meo Textile Clothing Co.LTD
Tcn Automatic Fast Food Breakfast Lunch Box Vending Machine for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Table Top Vending Machines Sale Combo Vending Machine
$ -
>=5 piec
Meo Textile Clothing Co.LTD
automatic soft ice cream vending machine with touch screen
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Condom and tissue vending machine
$ 500
>=1 Piece
Meo Textile Clothing Co.LTD
2021 Coin Operated Instant Tea/Coffee/Cafe Vending Machine for Sale WF1-303V
$ 160 ~ $ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Factory Hot Sale Arcade Prize Vending Game ATM Coin Bank Token Dispenser Coin Exchange Machine For Sale
$ 550
>=1 Set
Meo Textile Clothing Co.LTD
Bulk Vending Machines candy vending machine for sale
$ 154 ~ $ 183
>=1 piec
Meo Textile Clothing Co.LTD
baking hot food heating machine vending machine bread on sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
mindi orange juicer automatic big capsule gashapon for sale game machine vending machines smart
$ 90 ~ $ 98
>=1 piec
Meo Textile Clothing Co.LTD
Condom/customized Vending Machine
$ 65 ~ $ 70
>=20 Set
Meo Textile Clothing Co.LTD
Rokia OEM/ODM freezer frozen food ice cream vending machine with elevator system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
JSBS VCM4-3000 10.2 inch LCD screen cheap vending machine for 24hours sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
NNL-115 gumball vending machines for sale
$ 100 ~ $ 150
>=10 Piece
Meo Textile Clothing Co.LTD
Hot sale machines mini vending machine for bar
$ 395 ~ $ 445
>=1 piec
Meo Textile Clothing Co.LTD
Related Searches:
topvendingmachinecompaniesatlantiscoffeevendingmachinesodacanmachinelaysvendingmachinebestsellingvendingmachinecandysmartvendingsolutionsdrinkmachinenearmesimcardvendingmachinelavazzavendingvendingcoffeecafecoffeedayvendingmachinepricenectacoffeemachinepricecolavendingmachinehotvendingmachinessweetdispensermachinemechanicalvendingmachinemeivendingmachinecandymachinetoydrinkvendingmachinenearmefrozenfoodvendingmachinesdonutvendingmachinenewandusedvendingmachinesfooddispensermachinecakevendingmachinetoycapsulemachinesolarpoweredvendingmachineicecreamvendingmachineforsalegiftcardvendingmachinevendingsystemnorthwesternvendingmachines