Welcome to TradeChina
-
RELATED CATEGORIES:
Face Mask Vending Machine Mask Dispenser Medical Healthcare Product For Sale 24 Hours Self-service
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Full-automatic coin and bill operated payment soft ice cream vending machine for commercial use
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Kwang Hsieh Gas Pump Style mini candy Coin operated vending machine
$ 14.5 ~ $ 16
>=1000 Piece
Meo Textile Clothing Co.LTD
Hot coffee vending machine cup vending machine for coffee use
$ 115 ~ $ 185
>=1 piec
Meo Textile Clothing Co.LTD
Breaking news low price discount 50-200 L automatic fresh milk vending milk dispenser machine for apartment
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot sale pink kids coin operated game machine metal lucky twisted eggs vending machine
$ 450 ~ $ 550
>=1 Set
Meo Textile Clothing Co.LTD
cheap stationery elevator combo vending machine for food and drinks for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot beverage vending machine - Coin Mechanism
$ 198 ~ $ 200
>=50 Piece
Meo Textile Clothing Co.LTD
China Manufacturer Large Events Party Wedding Selfie Magic Mirror Photo Booth Vending Machine Sales
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Hotel use vending machine with QR code payment or note coin change
$ 200
>=10 Unit
Meo Textile Clothing Co.LTD
Hot!! Sale!! coin operated electric controller box timer for machine vending
$ 62.1 ~ $ 86.99
>=1 Unit
Meo Textile Clothing Co.LTD
Popular gumball vending machine hot sale automatical gumball machines
$ 115 ~ $ 120
>=5 piec
Meo Textile Clothing Co.LTD
Smart Vending Machine with Robot arm and lift elevator / carrier
$ -
>=10 Set
Meo Textile Clothing Co.LTD
Auto Face Mask Vending Machine Surgical Mask Vending Machine for Mask with Temperature Measurement Camera
$ 500 ~ $ 550
>=1 Piece
Meo Textile Clothing Co.LTD
Protein shake Vending Machine for gym
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
SCENTHOPE 2020 OEM/ODM Commercial Automatic Water Pizza Vending Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Whole sale automatic smart digital vending machine drink instant noodle lollipop pringles snack combo vending machine
$ 299 ~ $ 599
>=1 Set
Meo Textile Clothing Co.LTD
Hot sale self-service automatic drinking pure water vending machine Water and exquisite
$ 777
>=100 piec
Meo Textile Clothing Co.LTD
Bouncy Balls Gumballs Vending Capsules impact resistant Mechanical Vending Machines
$ 114.61 ~ $ 120.8
>=50 piec
Meo Textile Clothing Co.LTD
Commerical bottled water vending machine for gallon bottle
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New products iPad mirror photo booth machine floor stand digital japanese vending machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Magma S-711 AL | High Capacity Combo Vending Kiosk l Vending Machine for multipurpose
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Pharmacy Product Vending Machine Medical Supplies Medicine Hand Sanitizer Self-service Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin operation automatic drink vending machines
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Hot sale smart floor stand magic gift shopping mall nevera expendedora, automatic vending machines/
$ 594
>=2 piec
Meo Textile Clothing Co.LTD
museum/event coin stamping money operating game machine souvenir coin press machine for sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Mechanical 2 columns Vending Machine for Rolling paper and Lighters. OCB + CLipper
$ 171.42 ~ $ 230.53
>=1 Unit
Meo Textile Clothing Co.LTD
mobile food snack vending cart trailer truck van for griddle crepe drink
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
TCN cup noodle vending machine cafe coffee vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
XY-DLE-6C Slim Small Combo Refrigerated Vending Machine For Sale Snacks Drinks Beverages
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
ZG Factory Supply High Quality Vending Machine for Book/Magazine available
$ 970
>=1 Unit
Meo Textile Clothing Co.LTD
AF-S770 AFEN china gold supplier convenient storage medicine pharmacy products vending machines for sale
$ 899
>=1 Set
Meo Textile Clothing Co.LTD
24 Hours Self-service Vending Machine for Bagged Foods And Bottle Drinks
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Large Vending Machine Gumball, Big Ball Capsule Vending Machine For Sales
$ 180 ~ $ 190
>=2 piec
Meo Textile Clothing Co.LTD
2019 Coin Operated Instant Tea/Coffee/Coffe/Cafe Vending Machine for Sale
$ 170 ~ $ 300
>=100 Piece
Meo Textile Clothing Co.LTD
Vending machines for cell phone and cell phone accessories
$ -
>=1 piec
Meo Textile Clothing Co.LTD
vending machine for medical and beauty products without cooling system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic self-service pads vending machine for sale
$ 20 ~ $ 166
>=10 Piece
Meo Textile Clothing Co.LTD
2019 hot sale coin and token operated gumball toy vending machine gacha toys machine three players for cheap sale
$ 230 ~ $ 260
>=1 Piece
Meo Textile Clothing Co.LTD
New Concept Rotating Channel Wall Mounted Vending Machine For Snacks E-cigarettes
$ 576 ~ $ 599
>=1 piec
Meo Textile Clothing Co.LTD
Special apple juice vending machine outdoor equipment with cooling system
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Cigarettes& Gum& Condom Vending Machine Wall Mounted Type with Coin Operated
$ 300 ~ $ 500
>=1 Set
Meo Textile Clothing Co.LTD
Instant automatic hot noodle venidng machines vending machine for sale vending machines carvana vending machine
$ -
>=20 piec
Meo Textile Clothing Co.LTD
Micron 22 inch touch screen mystery happy box lucky box gifts vending machine for sale
$ 988
>=1 Set
Meo Textile Clothing Co.LTD
Mask Vending Machine
$ 198
>=10 piec
Meo Textile Clothing Co.LTD
Hot sale OEM Reverse Osmosis pure mineral water vending machines for sale purified water
$ -
>=3 Set
Meo Textile Clothing Co.LTD
China Supplier Reverse Osmosis Drinking Coin Operated Water Vending Machine For Sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
40 seconds a cup automatic big storage fresh fruit orange juicer vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China TCN-D720-10G Coin Operated AutomaticBeer Milk Beverage Vending Machines For Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Bathroom Beauty Kids Tennis Ball Vending Machine, OEM Bubble Gum Ball Vending Machine For Sale
$ 36 ~ $ 40.5
>=1 piec
Meo Textile Clothing Co.LTD
Related Searches:
frozenvendingmachinesodavendingmachinebusinessdrinkvendingmachinenearmesodacanmachinesmallsnackvendingmachinecoffeedaymachinecostcoffeevendomachineforsalebianchivendingmachinevendingmachinesforsaleebaysilentsalesforcegumballmachinedonutvendingmachinevendingsystemvendingmachineplacementicevendingmachinebusinessforsalepepsimachinessweetdispensermachinebusinesseslookingforvendingmachinescolavendingmachineexpendingmachinepopvendingmachineforsalesoftdrinkmachinepricelaysvendingmachineautomaticcoffeevendingmachinecoffeepremixforvendingmachinemechanicalvendingmachinevintagevendingsimcardvendingmachineicecreamvendingmachineforsalevendomachineforsalecoinoperatedcandydispenser