Welcome to TradeChina
-
RELATED CATEGORIES:
- Baby Children & Maternity
- Building Materials
- Electronics & Appliances
- Furniture & Decoration
- Homelife
- Industrial Machinery
- Agricultural Machinery
- Material Handling
- Commercial Equipment & Machinery
- Compressors, Refrigeration & Heating Equipment
- Construction & Building Machinery
- Fasteners & Processing Equipment
- Food & Beverage Machinery
- Home Goods & Chemical Product Manufacturing Machinery
- Logistics Technology & Transportation Systems
- Machine Tools & Metalworking
- Metallurgy, Minerals & Energy
- Power Transmission
- Packaging & Printing
- Metals & Alloys
- Woodworking Machinery
- New Energy
- Textiles & Garments
Zoomgu OEM ODM protein beverages proactive prices remote drink vending machine
$ -
>=2 Unit
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
Factory Price Combo Vending Machine for Snack and Cold Drink LE205A
$ -
>=2 Piece
Meo Textile Clothing Co.LTD
Top vending photobooth machine, 76 inch mirror photo booth machine factory price from China
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner Module
$ 62 ~ $ 75
>=2 piec
Meo Textile Clothing Co.LTD
Hot Sale Reasonable Price Mini Electric Ice Vending Cream Of Machine For Home
$ 385 ~ $ 425
>=1 Set
Meo Textile Clothing Co.LTD
RO Water Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Cheap Price Cosmetics Lipsticks Mascra Vending Machine With Lashes Dispenser
$ 988
>=1 Set
Meo Textile Clothing Co.LTD
TCN best selling snacks and drinks vending machine with competitive price
$ -
>=2 Set
Meo Textile Clothing Co.LTD
2020 Promotional Price Vending Machine For Snacks/Drinks/Chips
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Zoomgu China Supplier Best Choice Customized Coffee Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Latest American Standard Sexy Eyelash and Hair Vending Machine
$ 850
>=1 Set
Meo Textile Clothing Co.LTD
AFEN Self Service Automatic Food Drink Snack Vending Machine Price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Instant Coffee Vending Machine LE303V
$ 180 ~ $ 230
>=20 Piece
Meo Textile Clothing Co.LTD
Smart automatic face mask wall mounted vending machine with large capacity
$ 198 ~ $ 218
>=1 piec
Meo Textile Clothing Co.LTD
2021 Hot sale Zhongda brand custom self vending machine with advertising
$ -
>=1 Set
Meo Textile Clothing Co.LTD
self-service automatic drinking pure water vending machine
$ 699
>=1 Set
Meo Textile Clothing Co.LTD
Chinese Factory Price Robot Making Frozen Yogurt Vending ice cream Machine HM766C
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
big capsule vending machine
$ 55
>=15 Piece
Meo Textile Clothing Co.LTD
Automatic coffee tea hot chocolate vending machine price
$ 650 ~ $ 720
>=1 piec
Meo Textile Clothing Co.LTD
Low Price Vending Machine Small Wall Mounted Vending Machine For Office
$ 456 ~ $ 554
>=1 Set
Meo Textile Clothing Co.LTD
Water Dispenser/Water Purification selling vending Machine in factory price
$ 430 ~ $ 500
>=1 Set
Meo Textile Clothing Co.LTD
Fair price ice vending machine with auto bagging credit card vending machine robot vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Smart Coffee Vending Machine With Ice Maker
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
factory price instant powder tea coffee vending machine for Restaurant
$ 259
>=1 Piece
Meo Textile Clothing Co.LTD
very low price automatic soft ice cream vending machine with excellent service
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
32 Inch LCD Screen Freshly Ground Coffee Vending Maker with Cup Dispenser
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheap Price Small Mini Locker Vending Machines For foods and drinks
$ 760 ~ $ 800
>=5 Set
Meo Textile Clothing Co.LTD
OEM 2020 Popular Snack Vending Machine 11Channels Coin Operated Combo Vending Machine for Sale Promotion
$ 978
>=1 Set
Meo Textile Clothing Co.LTD
Adjustable LED ring light iPad photo booth best price iPad photo booth in Vending Machines
$ 850
>=1 Set
Meo Textile Clothing Co.LTD
Simple pizza vending machine with baking system and heating system fast delivery
$ -
>=3 piec
Meo Textile Clothing Co.LTD
Coin operated mask vending machine for sale China hotel vending manufacturer small mini snack pack machine dispenser
$ 89 ~ $ 199
>=100 piec
Meo Textile Clothing Co.LTD
Hot sale and low price vending machines +suppliers ZJ504T
$ 30
>=1 Piece
Meo Textile Clothing Co.LTD
Best Price And Good Quality Video Technical Support After-Sales Orange Juice Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Wholesale Cheap Price Spiral Candy Toy Gumball Vending Machine For Sale
$ 90 ~ $ 140
>=10 Piece
Meo Textile Clothing Co.LTD
water bottle vending machine pure fresh 800G water vending machine price/ro drinking water vending machine
$ -
>=2 Unit
Meo Textile Clothing Co.LTD
Factory price double-deck capsule toy vending machine capsule attractive gift vending machine
$ 147.6 ~ $ 158.4
>=1 piec
Meo Textile Clothing Co.LTD
China manufacturer Big size 10inch touch screen 24 channels cheap price snack drink vending machines for sale
$ 500
>=1 Piece
Meo Textile Clothing Co.LTD
Coffee vending machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Reverse Osmosis commercial Scan code coin automatic mineral pure water vedning machine price
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Hot Sales vending machine card payment wine vending machine facemask vending machine with wholesale price
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Original Factory 24hours KN95 price medical face mask vending machine with CE certificate
$ 100 ~ $ 800
>=1 Unit
Meo Textile Clothing Co.LTD
Factory price candy gum ball bouncy ball small capsule toy vending machine with drawer
$ 28 ~ $ 35
>=25 Piece
Meo Textile Clothing Co.LTD
coffee vending machine automatic vending machine instant powder coffee vending machine WF1-303A
$ 150 ~ $ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Factory cheapest price coin operated ice water vending machine for sale
$ -
>=3 piec
Meo Textile Clothing Co.LTD
Coffee/milk/Cafe Vending Machine Professional Instant Coffee Vending machine for Sale WF1-306B
$ 300 ~ $ 400
>=1 piec
Meo Textile Clothing Co.LTD
sale high quality Ice and water vending machine/distributor automat vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coffee vending machine with advertisement video
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Kwang Hsieh 9 Inch Factory Price Black Coin Capsule Vending gumball Machine
$ 5.5 ~ $ 6
>=5700 Piece
Meo Textile Clothing Co.LTD
Related Searches:
solarpoweredvendingmachinelavazzavendingautomaticchocolatevendingmachinepepsimachines1950scokemachinecandyvendingmachinebusinesswatervendingvendingshopcafecoffeedayvendingmachinepricecakevendingmachinehotmealvendingmachinesweetdispensermachinedrinkvendingmachinenearmegachavendingmachineexpendingmachinesodamachinecostvendingmachinelocatorsgumvendingmachineicevendingmachinebusinessforsaleusedcombovendingmachinesnewandusedvendingmachinesusedcokemachineoldpepsivendingmachinecolavendingmachinevendingsystemvendopepsimachinemilkvendingmachinepricevendingsupplyintelligentvendingmachinevendingmachineshop