Welcome to TradeChina
-
RELATED CATEGORIES:
24 hours self-service automatic vending machine/vending locker
$ -
>=5 Unit
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
RO Water Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner Module
$ 62 ~ $ 75
>=2 piec
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machine
$ 130 ~ $ 138
>=10 piec
Meo Textile Clothing Co.LTD
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare Parts
$ 90
>=10 piec
Meo Textile Clothing Co.LTD
AUTO-sale Vending t-handle lock vending machine parts
$ 7.8
>=200 Piece
Meo Textile Clothing Co.LTD
Zhongda e-cigarette e cig Vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Integrated Automatic Payment Vending Machine Shell Self-service Check-in Sheet Metal Box
$ 318 ~ $ 341
>=1 Piece
Meo Textile Clothing Co.LTD
Mini Vending Machine 3 Selections of Hot Drink Water Gallon or Connect to Tap Water Small Digital Led Display
$ 200 ~ $ 999
>=2 Unit
Meo Textile Clothing Co.LTD
Capsule Toy Vending Machine Coin Accepted Transparent Colour Toy Distributor with Led Light
$ 145 ~ $ 160
>=1 piec
Meo Textile Clothing Co.LTD
Vending machine distributor for smart mini vending machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
ZG High Quality Drink Cafe Snack Vending Machine Distributor Automatic With Ce Certification
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
TCN Soda and snack vending machines snacks beverages combo machine phil distributors
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Rokia White Oem/odm And Cold Drink Automatic Distributors Fast Food Dispenser Nutritious Snack Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
cheap spiral bubble gum vending machine distributor
$ 112 ~ $ 115
>=1 piec
Meo Textile Clothing Co.LTD
Hot Sale:journal vending machine,magazine vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Afen configurable gym vendor machine dispense healthy drinks food vending machine operated by coin and bill
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 Looking for Exclusive Distributor 2-in-1 Coin Banknote Payment Operated Charging Cable WiFi Vending Machine
$ 427 ~ $ 446
>=1 Unit
Meo Textile Clothing Co.LTD
Digital Mini Automatic Vending Machine For Snack and Drink Beverage Soft Drink Soda Juice
$ -
>=1 piec
Meo Textile Clothing Co.LTD
New Invest Masks Vending Machine Masks Distributor For Sale
$ 600
>=1 Piece
Meo Textile Clothing Co.LTD
NNL-110 candy vending machine distributor
$ 30 ~ $ 60
>=20 Piece
Meo Textile Clothing Co.LTD
fresh orange juice vending machine looking for distributor from worldwide
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Standing Commercial Espresso Coffee Machine Orange Fruit Juice Vending Machine
$ 650 ~ $ 720
>=1 piec
Meo Textile Clothing Co.LTD
combo vending machine food snack distributore automatico vending machine food snack
$ 847.6 ~ $ 877.4
>=5 piec
Meo Textile Clothing Co.LTD
OEM/ODM automatic fast food breakfast rice healthy lunch box vending machine for sale
$ -
>=1 Acre(s)
Meo Textile Clothing Co.LTD
Card Reader Distributore Automatico Chocolate Pringles Salad Newspaper Sunglass Distributore Automatico
$ 652.8 ~ $ 816
>=1 piec
Meo Textile Clothing Co.LTD
sale high quality Ice and water vending machine/distributor automat vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Wholesale Distributor Automatic Face Mask Vending Machine Surgical Mask Vending Machine
$ 198 ~ $ 218
>=1 piec
Meo Textile Clothing Co.LTD
Ice and water vending machine/distributor automat vending machin/juicer vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Distributor Cosmetics Products Vending Kiosk with Robotic
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
automatic bulk\/mini\/candy\/distributor vending machines
$ 10 ~ $ 30
>=100 Piece
Meo Textile Clothing Co.LTD
Purified Water & Crystal Ice Venidng Machine with auto bagging system and seal function
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
AMA OEM ODM Fresh salad vending machine conveyor belt vending machine with elevator
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Hair Removalipl Machine Beauty Equipment New Style Nail Art Vending Machine Portable Diode Laser 3 Years Free Repair
$ -
>=1 Unit
Meo Food Co., Ltd.
Distributore Automatico Protein Shake Coffee Vending Machine With Tempered Glass
$ -
>=1 Set
Meo Textile Clothing Co.LTD
HUIZU Micron Distributore automatico di maschere facciali
$ -
>=1 Set
Meo Textile Clothing Co.LTD
4 hot and 4 cold Office and school fully instant tea and coffee machine with favorable price WF1-404A
$ 210 ~ $ 300
>=1 piec
Meo Textile Clothing Co.LTD
Factory Price Food Cigar Book Drink Vending Machine For Hospital Cinema Office Subway Station
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Funny Capsule Toys Distributors Gashapon Vending Machine for Maquina Expendedora
$ 132 ~ $ 160
>=1 piec
Meo Textile Clothing Co.LTD
China Manufacturer Supply distributor Automatico Di Yogurt Automatic Vending Iceice Cream Hard Making Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
candy gumball capsule vending machine with coin drawer
$ 32 ~ $ 34
>=100 piec
Meo Textile Clothing Co.LTD
Hot selling Commercial 24hours Self-service Small face mask distributor vending machine for sale
$ 200 ~ $ 599
>=1 piec
Meo Textile Clothing Co.LTD
Chunchuan large and small mini drink snack automatic vending machine for sales
$ -
>=15 Set
Meo Textile Clothing Co.LTD
Product Distributor Opportunities Candy Vending Machine Business
$ 499
>=1 Set
Meo Textile Clothing Co.LTD
TCN Automatic 32 HD display screen distributor food vending machine
$ -
>=20 Set
Meo Textile Clothing Co.LTD
Hot Sell Vending Machine Snacks and Drinks & Combo Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2019 pizza machine distributrice pizza distributor machine for shops malls supermarket
$ -
>=1 Set
Meo Textile Clothing Co.LTD
27mm bouncy balls vending machine ZJ503T(distributor automatic bibite usati)
$ 30
>=1 Piece
Meo Textile Clothing Co.LTD
Related Searches:
minipopmachinecandymachinetoycoinoperatedcandydispenservendingcoffeenewandusedvendingmachinesskittlesvendingmachineforsalelaysvendingmachinemeivendingmachineatlantiscoffeevendingmachinevendingmachineshopbubblegumvendingmachinecoffeevendomachineforsalecafecoffeedayvendingmachinepriceretrocokemachinevendingsupplyicecreamvendingmachineforsalesimcardvendingmachineantaresvendingmachinewatervendinggumvendingmachinemechanicalvendingmachinecommercialvendingmachinesmartvendingsolutionslypcgumballmachinedonutvendingmachinecarddispensermachine1950scokemachinevendingmachinesforsaleebaypizzafornovendingmachinecolavendingmachine