Welcome to TradeChina
-
RELATED CATEGORIES:
Kubota main pump KX63,K035,KX175,KX165 excavator hydraulic pump KX121-2,KX92-1,KX161,KX42,KX43,KX45,KX65,KX61,KX91-2,KX172,KX85
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machine
$ 130 ~ $ 138
>=10 piec
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner Module
$ 62 ~ $ 75
>=2 piec
Meo Textile Clothing Co.LTD
smart 24 hours self-service automatic milk food snack drink vending machine for milk food snack and drinks
$ -
>=27 Set
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Wholesale Hot Sale Custom Multifunctional Medical Mask Vending Machine
$ 150 ~ $ 300
>=1 piec
Meo Textile Clothing Co.LTD
6 bottle wine dispenser fridge mini vending machine for sale
$ -
>=1 piec
Meo Textile Clothing Co.LTD
HOT Sale Commercial Coffee Vending Machine with 3 Flavor Drinks
$ 229 ~ $ 400
>=2 Set
Meo Textile Clothing Co.LTD
Integrated Automatic Payment Vending Machine Shell Self-service Check-in Sheet Metal Box
$ 318 ~ $ 341
>=1 Piece
Meo Textile Clothing Co.LTD
intelligent android vending machine for beverage with advertising function
$ -
>=2 Unit
Meo Textile Clothing Co.LTD
TCN automatic fast food breakfast lunch box vending machine for sale
$ -
>=3 Set
Meo Textile Clothing Co.LTD
GV25 New business ideas kids toys vending machines for sale
$ 55
>=15 Piece
Meo Textile Clothing Co.LTD
400G RO coconut Water Filter water vending machine business for sale
$ -
>=3 piec
Meo Textile Clothing Co.LTD
Mini Simple Small Size Cheap Snacks Fresh Milk Can Coin Operated Purified Water Coffee Vending Machine Business For Sale
$ 20 ~ $ 70
>=500 Set
Meo Textile Clothing Co.LTD
new business ideas coin operated water vending machine lift for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN business card automatic condom vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN Small counter top vending machines for sale business
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2019 hot business automatic drink vending machine/bulk vending machines for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Best Quality Small Items Vending Machine Business For Sale
$ 350 ~ $ 400
>=1 Piece
Meo Textile Clothing Co.LTD
24 Hours Outdoor Business Self-service Food Vending Machine Pizza Vending Machines For Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
business wall mounted cigarette vending machine for sale
$ 549.99
>=1 Set
Meo Textile Clothing Co.LTD
vendor machine business for sale toy vending machine plastic capsules with 24 hour service toy mini vending machine for sale
$ 139 ~ $ 145
>=1 Piece
Meo Textile Clothing Co.LTD
Attractive design customized cartoon characts vending machines profitable business
$ -
>=10 Set
Meo Textile Clothing Co.LTD
Large Globe Gumball Bubble Vending Machine with Removable cash box single Stand
$ 42.5 ~ $ 44
>=10 Set
Meo Textile Clothing Co.LTD
Large Globe with Removable cash box single Stand Outdoor Toy Gumball Vending Machine For sale
$ 39 ~ $ 69
>=1 Piece
Meo Textile Clothing Co.LTD
new business ideas vending machine self cheap automatic vending machine/popcorn vending machine/vending machines for sale
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Business Startup Idea New Products to Sell for Small Business
$ 372 ~ $ 389
>=1 Unit
Meo Textile Clothing Co.LTD
2019 New Business 22inch Touch Screen Protein Drinks Vending Machine in Thailand
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Hot Coffee Tea Chocolate Table Top Fully Automatic Coffee Vending Machine
$ 230 ~ $ 400
>=2 Set
Meo Textile Clothing Co.LTD
High Quality Products Claw Vending Machine Indoors Prize Machines
$ 630 ~ $ 650
>=1 Unit
Meo Textile Clothing Co.LTD
Combo Cold Snack cheap vending machine Auto Vending Machine WD1-205A
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
2017 China wholesale factory instasnap Portable Photo kiosk / photobooth / photo booth shell for sale for business/vending/party
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Alibabaselect custom black vending machine / venting machine for vape snack food and drink beverage business in philippines
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
Big Capacity High-end Business 24 hours Automatic Wine Vending Machine Price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New 2021 Automatic double chamber triangle inner outer tea bag pouch packing machine for small business
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Orange juice vending machine with squeezing juice system and cleaning system
$ -
>=10 piec
Meo Textile Clothing Co.LTD
High Quality triple candy vending machine for sales
$ 75
>=700 Piece
Meo Textile Clothing Co.LTD
TCN brand snacks and beverage mini vending machine business
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Lil Wizard Spiral Vending Mechanical Gumball Machine for Bubble Gum, Candy
$ 120 ~ $ 140
>=20 Piece
Meo Textile Clothing Co.LTD
vending machine make more money with ad~design your own new customized eco-friendly business mineral or hydrogen or RO water
$ -
>=2 Unit
Meo Textile Clothing Co.LTD
SNBC BVM-RI300 New Business Ideas Vending Machine For Foods And Drinks Flowers Black Vending Machine For Sale Cosmetics
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Fresh- juice vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High Quality Automatic Electronic Card Dispenser Machine for Parking Charge Vending Machine
$ 100 ~ $ 130
>=1 Unit
Meo Textile Clothing Co.LTD
Aluminum Alloy body Square container candy gumball dispenser vending machine
$ 33 ~ $ 38
>=10 Piece
Meo Textile Clothing Co.LTD
Wall-mounted 24 Hours Self-service Skin Care Vending Machine Face Mask Vending Machine Surgical Mask Vending Machine
$ 270 ~ $ 330
>=1 Unit
Meo Textile Clothing Co.LTD
Touch Screen Self Smart Instant Noodle Vending Machine Business
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Forkwin Gumball Machine with Candy Capacity Dispenser Capsule gift Red Candy Vending Machine for Home use Business
$ 36 ~ $ 40.5
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Gift Card Vending Machine RFID and SIM Electronic Card Card Dispenser
$ 100 ~ $ 130
>=1 Unit
Meo Textile Clothing Co.LTD
New Series Floor Standing Business Photo Booth With Printer Vending Kiosk
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Related Searches:
nescafecoffeevendingmachinepriceicevendingmachinebusinessforsalegiftcardvendingmachinecandyvendingmachinebusinessteaandcoffeemachineforofficedrinkmachinenearmevendingmachinebusinessforsalenearmetopvendingmachinecompaniesbestcoffeevendingmachinesnectacoffeemachinepricecommercialvendingmachinesolarpoweredvendingmachinevendopepsimachinenorthwesternvendingmachinesrunningavendingmachinebusinesssoftdrinkmachinepricevendingmachinesforsaleebaywatervendingusedcokemachinecafecoffeedayvendingmachinepricenestlecoffeevendingmachineantaresvendingmachinevintagesodamachinesforsaleicecreamvendingmachineforsaletoycapsulemachinesnacksvendingmachinepricegumvendingmachinehotvendingmachinesminipopmachinefooddispensermachine