Welcome to TradeChina
-
vaseline body/vaseline petroleum jelly snow white/vaseline for afro natural hair
$ 800
>=1000 metric ton
Meo Machinery Co.LTD
Petroleum Jelly White Vaseline /Medicated vaseline petroleum jelly/vaseline advanced repair lotion
$ 800
>=1000 metric ton
Meo Machinery Co.LTD
Imaj skin care vaseline for hands feet and body 75 ml
$ 0.5 ~ $ 4
>=1 Piece
Meo Food Co., Ltd.
Automatic production line small scale mozzarella cream dairy processing cheese making machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Vaseline Wax Well Water Packing Hot Filler Bottling Filling Machine Equipment Production Line
$ -
>=1 Set
Meo Textile Clothing Co.LTD
100ml 200ml 300ml simple design PET oil bottle for hair care mouth wash bottle
$ 0.19
>=10000 piec
Meo household Co.LTD
hair wax making machine vertical high precision bottle filling machine ointment heating mixing filling machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High performance hair wax/thick paste heating mixing filling machine
$ 400
>=1 Set
Meo Textile Clothing Co.LTD
Vacuum Emulsifying Machine for Vaselin Making Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Vaseline Pomade Wax Hot Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Amazon Hot selling 500g Black Depilatory Wax Pellet Film Hard Wax Bean For Hair Removal
$ 2 ~ $ 2.88
>=6000 Box(es)
Meo Food Co., Ltd.
High viscous product cosmetic lotion vaselin hair dye hair dye emulsifying making machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
50 L 100 L Vaseline Making Mixing Machine Cosmetic Mixer Vacuum Homogenizer Emulsifier Blend Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hair Care Vacuum Emulsifier High Shear Dispersing Emulsifiers Vaseline Making Machine Ointment Vacuum Mixer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Yuxiang 1000L 2000L 10000L vacuum emulsifying machine for vaselin making equipment
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Price Body Lotion Cosmetic Vaseline Cream Emulsifying Making Machine Vacuum Homogenizer Mixer Emulsifier
$ 745
>=1 Piece
Meo Textile Clothing Co.LTD
Bubble moisturizing and deep cleansing facial & body & hair cleanser
$ 3 ~ $ 5
>=100 Box(es)
Meo Food Co., Ltd.
170kg drum packing Vaseline / Petroleum Jelly manufacturer in China
$ 0.8 ~ $ 1.6
>=1000 Kilogram
Meo Machinery Co.LTD
vaseline hair tonic/vaseline oil/vaseline healthy white
$ 800
>=1000 metric ton
Meo Machinery Co.LTD
Imaj skin care vaseline for hands feet and body 125 ml
$ 0.5 ~ $ 4.3
>=1 Piece
Meo Food Co., Ltd.
50-5000L Skin Care Cream Vacuum Emulsifying Mixer Machine Hair Wax Vaseline Homogenizer Equipment for Cosmetics Chemicals
$ -
>=1 Set
Meo Textile Clothing Co.LTD
800g depilation hard wax for hair removal
$ 3 ~ $ 4.2
>=240 Piece
Meo Food Co., Ltd.
best selling neo hair body vaseline pump lotion
$ 0.73 ~ $ 0.9
>=20 piec
Meo Food Co., Ltd.
Semi-automatic Heated Mixing Hopper Vaseline Paraffin Oil Heavy Head Paste Heater Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Depilatory Wax Filler Hand Leg Hair Removing Wax Hot Filling Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
LIENM Factory Automatic double heads constant temperature filler for vaseline, wax
$ -
>=1 Set
Meo Textile Clothing Co.LTD
LIENM factory high viscous honey butter hair wax heating and mixing filling machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Private label essential arganic Morocco argan oil vaseline hair tonic care korea
$ 2.48 ~ $ 3.81
>=3 piec
Meo Food Co., Ltd.
vaseline moisturizer cream /body lotion vaseline/vaseline after care tattoo
$ 800
>=1000 metric ton
Meo Machinery Co.LTD
Manufacturer Automatic Vaseline Hair Wax Filling Machine Heating Cream Gel Filling Machine With Mixer And Bottle Unscrambler
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Pneumatic Bottling Machine Heating Device For Hot Paste Bottle Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Eco-friendly 30g 50g PP Plastic Jar Vaseline Cream Jar For Cosmetic Packaging
$ 0.22
>=10000 piec
Meo household Co.LTD
Semi--automatic Hot Aluminum Can papaya Sauce Pandan Paste Paraffin For Hair Wax Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Electric Heating Jacket Stirrer Hopper Bottle Jar Wax Balm Oil Candle Vaseline Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Heating Mixing Piston Filler Big Hopper Density Paste Chili Sauce Liquid Paraffin Hair Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Hair Removal Paste Remover Liquid Hairdressing Sugar Oil Dye Cream Wax Gel Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CE Standard Pneumatic Double Head Heating Device For Hot Chili Sauce Paste Bottle Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Jacket Mixer Hopper Lip Balm Oil Vaseline Hair Wax Tube Jar Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Hopper Small Mixer Hot Vaseline Water Bottle Tea Juice Drink Wax Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pneumatic Wax Vaseline Jam Hot Juice Sauce Mixing Tank Hopper Stirrer With Heater Heating Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
40g Luxury Diamond Empty Cosmetic Container Cream Package Acrylic Jar
$ 0.76
>=10000 Piece
Meo household Co.LTD
professional and well packed 300g, 500g or 1kg elastic honey scented bead hot wax
$ 2 ~ $ 2.2
>=240 Piece
Meo Food Co., Ltd.
Cosmetic Grade White Mineral Oil
$ 900
>=1 metric ton
Meo Machinery Co.LTD
Hard Wax Beans(Hot Film)
$ 2 ~ $ 2.2
>=240 Piece
Meo Food Co., Ltd.
Semi Automatic Multifunctional Pneumatic Hot Chili Sauce Bottle Juice Small Cream Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Piston Chocolate Tube Mold Cream Beverage Choco Stick Choco Paste Choki Liquid Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Guangzhou suppliers depilatory wax factory
$ 2.2 ~ $ 3
>=240 Piece
Meo Food Co., Ltd.
Semi-automatic Hot Hopper Juice Liquid Orange Concentrated Car Shampoo Heating Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Hopper Degreaser Lube Lubricant Essential Engine Cleaner Wax Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Professional Manufacturer Protein Syrup Mascara Eyelash Juice Cup Pudding Hot Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
equatevaselinepetroleumjellyfordrylipspetroleumjellyforrashesvaselineantiacnevaselinealoeverapetroleumjellypricevaselinehealthywhiteprice400mlvaseline350mlvaselineskinjellypurepetroleumvaselineintensivecarealoesoothe400mlvaselineskinwhiteningvaselinehealthybodyglowvaselinepetroleumjelly100mlvaselineintensivecareadvancedrepaireczemavaselineintensivecareessentialhealingvaselineintensivecarecocoaradiantwithpurecocoabutterpetroleumjellyproductsvaselinecostvaselinealoesoothevaselinebluesealaloefreshvaseline200mlvaseline600mlvaselinewhitepetroleumjellybiolinewhitepetroleumjellyvaseline1.75ozvaseline13ozvaselinecarevaselinetotalmoisturecocoaglowvaseline250mlpricevaselinegifttin