Welcome to TradeChina
-
Vaselin Smoothing Body Butter container 250ml roundwhite cosmetic plastic PP body cream jar
$ 0.22
>=10000 piec
Meo household Co.LTD
vaseline gauze/vaseline 50ml/vaselin price
$ 800
>=1000 metric ton
Meo Machinery Co.LTD
Original Vaselin Petroleum Jelly Ready Stock 50ml
$ 8.88
>=5000 ca
Meo Machinery Co.LTD
White Skin Care Vaselin 50ml Medicated Petroleum Jelly
$ 177.33 ~ $ 295.55
>=1000 metric ton
Meo Machinery Co.LTD
Direct Factory Price 50ml White Vaselin /Petroleum Jelly
$ 177.54 ~ $ 295.9
>=1000 metric ton
Meo Machinery Co.LTD
High Quality Medical Grade 50ml White Vaselin Petroleum Jelly Oil
$ 0.32
>=400 piec
Meo Machinery Co.LTD
Wholesale Cheap Vaseline cream jar for skin care 7g 50g 100g empty vaseline jars
$ 0.08 ~ $ 0.28
>=5000 Piece
Meo household Co.LTD
7g 50g 100g empty plastic personal skin care cosmetic vaselin cream jar
$ 0.15
>=10000 piec
Meo household Co.LTD
Semi-automatic Piston Pharmacy Paste Vaseline Mixer Balm Filling Machine Mixing Heated
$ -
>=1 Set
Meo Textile Clothing Co.LTD
1oz 2oz 3oz 4oz beauty cream container vaseline body lotion jar with lid
$ 0.2 ~ $ 0.4
>=1000 Piece
Meo household Co.LTD
100g pp flip cap petroleum jelly cream vaselin jar
$ 0.22
>=10000 piec
Meo household Co.LTD
Eco-friendly PP 30ml 50ml 100ml 150ml cosmetic jars for skincare cream
$ 0.28
>=5000 piec
Meo household Co.LTD
liquid filling machine liquid filling machine vaseline body lotion
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heated Mixing Hopper Vaseline Paraffin Oil Heavy Head Paste Heater Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
50ml Standing Pneumatic Cosmetic Honey Electric Heating Filler Vaseline Cream Mixing and Dispensing Machines For Small Business
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High Efficiency Fully Automatic Vaselin Sachet Packing Machine for Liquid/cream Small Pouch Packing Machine 60-80bags/min 1-50ml
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Sale Skin Care White 50ml White Petroleum Jelly
$ 0.32
>=400 piec
Meo Machinery Co.LTD
Semi-automatic Electric Heating Jacket Stirrer Hopper Bottle Jar Wax Balm Oil Candle Vaseline Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Hopper Small Mixer Hot Vaseline Water Bottle Tea Juice Drink Wax Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Jacket Mixer Hopper Lip Balm Oil Vaseline Hair Wax Tube Jar Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pneumatic Wax Vaseline Jam Hot Juice Sauce Mixing Tank Hopper Stirrer With Heater Heating Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Tube Piston Jar Cream Filler with Mixer Parfum Paste Filling Machine With Hopper
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Good Quality 2021 Guangzhou Oil Filling Machine 304 Steel Liquid Filling Machine
$ 950
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic High Quality Syringe Lighter Efficiency Paste Heating Element Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Mixing Filler Bottle Cream Hot Filling Machine With Heater And Mixer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Competitive Price Pouch Filling Machine Shower Gel Shampoo Bag Packer Packing Machine Liquid Sachet Filling and Sealing Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Manufacturer Heating Mini Water Oil Vial Juice Mineral Mixing Filling Machine Line
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China 1 Gallon PET Bottle Wax Candy Seman Spray Nail Gel Filling Machine With Stirring Tank
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Sorting Table Litchi Hot Sauce Liquid Bottle Juice Filling Machine Manual
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Heating And Mixing Hdpe Bottle Sanitizer Hand Wash Liquid Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Manufacturer Passion Fruit Jam Part of Bottle for Liquid Paraffin Wax Paper Cup Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Multifunctional Pneumatic Hot Chili Sauce Bottle Juice Small Cream Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Piston Chocolate Tube Mold Cream Beverage Choco Stick Choco Paste Choki Liquid Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Manufacturer Milk Empty Glass Nail Polish Bottle Cone Filling Machine With Liquid Mixing Tank
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Small Electric Manual Pet Plastic Bottle Tube Sachet Juice Water Perfume Oil Pouch Filling Machine
$ 700 ~ $ 750
>=1 Set
Meo Textile Clothing Co.LTD
Guangzhou Heating Hopper with Mixer Hot Salve Bottle Jar Jam Cream Lotion Oil Sauce Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
YHGZJ- Wax injection machine with heating system
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Small Piston Beverage Honey Shampoo Nail Cosmetic Plastic Paint Bottle Liquid Paste Packing Filling Machine
$ 920
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Hopper Degreaser Lube Lubricant Essential Engine Cleaner Wax Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Hot Hopper Juice Liquid Orange Concentrated Car Shampoo Heating Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Professional Manufacturer Protein Syrup Mascara Eyelash Juice Cup Pudding Hot Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-Automatic Heated Jacket Coffee Mascara Lipstick Grade Lip Balm Petroleum Jelly Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Use Semi-automatic Energy Fruit Juice Honey Energetic Drink Hot Bottling Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheapness Semi-automatic Heating Peanut Butter Sauce Cheese Spread Cream Cup Paste Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CE High Quality Caramel Sauce Liquid Mushroom Paste Semi-Auto Piston Stirring Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi-automatic Heating Hopper Lemonade Water Oil Preservative Drink Lemon Juice Hot Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pet Bottle Detergent Ketchup Petroleum Jelly Melting Hot Juice Liquid Heating Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Pneumatic Bottling Machine Heating Device For Hot Paste Bottle Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Lotion Oil Lipstick Hot Cheese Spread Paste Cream Heating Mixing Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Hot Sauce Small Bottled Water Heated Hopper Tomato Paste Honey Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
vaselineskinprotectantvaselinecocoaglowpricevaselinecocoabodybutterpetroleumjellyointmentvaselinepurerepairingjellyvaseline13ozvaseline250mlpricenewvaselinevaselinehealthybodyglowvaselineantiacnevaselinegifttinvaselinemenextrastrengthvaselinerepairingjellyoriginalvaselinealoeverapetroleumjellypricevaselinepetroleumjelly100mloilvaselinevaselineintensivecarehealthybodyglowvaselineintensivevaselinejellyforfacevaselinefortattooaftercarepetroleumjelly1kgpriceminivaseline7gvaselinesetvaseline350mlvaselinehealthywhiteprice400mlvaselineintensivecarepetroleumjellyvaselinecoconutvaselinecocoaglowforfacevaselineeyelashvaselineintensivecarealoesoothe400ml