Welcome to TradeChina
-
New Shelves mosquito lamp trap With Strong suppliers
$ 1.95
>=10 Piece
Meo Food Co., Ltd.
6 volt UV light insect hunter bulb trap
$ 115 ~ $ 120
>=10 piec
Meo Food Co., Ltd.
Electric LED Insect Mosquito Fly Killer Bug Zapper UV Home Indoor Pest Catcher Trap Mosquito Killer Lamp
$ 7.8 ~ $ 8.8
>=5 piec
Meo Food Co., Ltd.
Newest Style Portable Electric DC 5V Camping Insect Mosquito Killer Trap Lamp Machine Bug Zapper
$ 3.2 ~ $ 5.8
>=20 Piece
Meo Food Co., Ltd.
NEW Usb Mosquito Repellent Bug Insect Trap Fly Repeller UV Light Photocatalyst Mosquito Killer Lamp
$ 3.19 ~ $ 3.37
>=5 piec
Meo Food Co., Ltd.
2020 Newest Electric Led Usb Insect Machine Electronic Indoor Chemical Spray Fan Trap Mosquito Killer Lamp
$ 2.88 ~ $ 2.98
>=2 Pack
Meo Food Co., Ltd.
2500V Electric Mosquito Killer With UV Lamp USB 1200mAh Rechargeable Bug Zapper Summer Fly Swatter Trap Home Bug Insect Racket
$ 4.5 ~ $ 4.96
>=50 piec
Meo Food Co., Ltd.
New technology LED USB powered UV fly flies insect killer light trap led mosquito lamp mosquito repellent
$ 1.65 ~ $ 2.48
>=1 piec
Meo Food Co., Ltd.
Mosquito Killer lamp Bug Insect Trap UV Light Killing Lamp
$ 3.5
>=50 Box(es)
Meo Food Co., Ltd.
Amazon Hot sale Usb Battery Rechargeable, Electrical Inhale Style LED UV Light Mosquito Killer Lamp for Home Indoor
$ 7.89 ~ $ 11.9
>=2 piec
Meo Food Co., Ltd.
New USB Powered UV LED Electronic Indoor Mosquito Killer Trap Lamp
$ 5.4
>=3000 piec
Meo Food Co., Ltd.
Wholesale indoor & outdoor UV led electric mosquito zapper insect killer
$ 6 ~ $ 7.8
>=2000 Piece
Meo Food Co., Ltd.
360 UV light electric mosquito killer lamp 6W
$ 5.9 ~ $ 6.5
>=100 piec
Meo Food Co., Ltd.
electric Mosquito Killer lamp Fly Bug Zapper indoor UV electric anti mosquito killer insect lamp machine
$ 5.4 ~ $ 13.6
>=1 piec
Meo Food Co., Ltd.
Patent Product New Usb UV Led Electric Mosquito Killing Lamp With Led Light
$ 7.6 ~ $ 7.85
>=1000 piec
Meo Food Co., Ltd.
Hot Selling UV Pest Control Repeller Light Bug Zapper 365 Mosquito Repellents Killer Lamp
$ 1.09 ~ $ 1.89
>=50 piec
Meo Food Co., Ltd.
Photocatalyst Insect Trap Lamp Killer Uv Led Mosquito Trap Night Electric
$ 4.5 ~ $ 6.5
>=1 Piece
Meo Food Co., Ltd.
AC175~220V LED Mosquito Killer Bulb E27/B22 LED Bulb For Home Lighting Bug Zapper Trap Lamp Insect Anti Mosquito Repeller Light
$ 0.77 ~ $ 1
>=2 piec
Meo Food Co., Ltd.
Purple led bionic fan trap lamp usb indoor electric insect mosquito led killer
$ 5 ~ $ 6
>=2 piec
Meo Food Co., Ltd.
Best price good quality electronic effective mosquito insect killer lamp with uv light
$ 14 ~ $ 16
>=100 piec
Meo Food Co., Ltd.
E27 LED Anti Mosquito Killer Bulb LED Bulb for Home Lighting Bug Zapper Trap Lamp Insect Anti Mosquito Repeller Light Dropship
$ 1.8
>=10 Piece
Meo Food Co., Ltd.
New UV Electric LED Home Zapper Insect Trap Mosquito Killer Lamp with USB
$ 1.41 ~ $ 3.09
>=5 piec
Meo Food Co., Ltd.
2019 USB Photocatalyst Mosquito Killer lamp Mosquito Repellent Bug Insect Trap Light UV Light Killing Trap Lamp Fly Repeller
$ 2.98 ~ $ 3.58
>=2 piec
Meo Food Co., Ltd.
3000V Electric Mosquito Killer With UV Lamp USB 1200mAh Rechargeable Bug Zapper Summer Fly Swatter Trap Home Bug Insect Racket
$ 4.3 ~ $ 6.9
>=10 piec
Meo Food Co., Ltd.
Mosquito Killer Lamp Trap Killing Machine Electric Fly insect Bug Zapper Repellent Trap Pest Repeller Control Reject Light Bulb
$ 1.29 ~ $ 3.99
>=2 piec
Meo Food Co., Ltd.
7indoor commercial portable insect inhaler zapper trap pest repeller tueur de moustiques UV lamp tube LED mosquito killer lamp
$ 3.1 ~ $ 3.72
>=500 Piece
Meo Food Co., Ltd.
SJZ Flying Insect Repellent Trap Bug Zapper Control Reject Product Mosquito Killer Lamp Anti Pest fly control
$ 3.53 ~ $ 4.52
>=160 piec
Meo Food Co., Ltd.
Pest Control Repeller Plastic Mosquito Killer Insect Zapper Fly Trap Light
$ 0.6 ~ $ 0.9
>=100 piec
Meo Food Co., Ltd.
3000V electronic mosquito killer UV Lamp USB 1200mAh Rechargeable Bug Zapper Summer Fly Swatter Trap Home Bug Insect Racket
$ 3.5 ~ $ 5.9
>=200 piec
Meo Food Co., Ltd.
Electric Electronic Uv Light Led Outdoor Usb Insect Machines Mosquito Killer Lamp 12v uv sterilizer
$ 1.88 ~ $ 3.76
>=10 piec
Meo Food Co., Ltd.
Electric Mosquito Killer with Trap Lamp, Chemical-Free USB Powered UV LED Light Photocatalyst Fly Bug Dispeller with Suction Fan
$ 2.5 ~ $ 3.5
>=1 Set
Meo Food Co., Ltd.
Electric Bug Zapper Pest Repeller Control Traps Eliminator Catcher Lure Led Uv Mosquito Killer Lamp
$ 15.6 ~ $ 18
>=2 piec
Meo Food Co., Ltd.
UV Light bug zapper electric flying zapper portable standing or hanging electric mosquito killer for Indoor Use
$ 2.1 ~ $ 2.5
>=200 piec
Meo Food Co., Ltd.
High Quality USB Powered UV LED Photocatalyst Fly Bug Mosquito Killer Trap Lamp and Quiet Fan Inhaler
$ 1.99 ~ $ 3.49
>=10 piec
Meo Food Co., Ltd.
2020 Indoor Home Quiet LED Killing Bug Zapper Portable USB Electric Anti Mosquito Killer Lamp Insect Mosquito Trap Lamp
$ 1.25 ~ $ 2.5
>=50 Piece
Meo Food Co., Ltd.
2020 New USB Chemical-Free Powered Electric Mosquito Killer with UV LED Light Photocatalyst Trap Lamp and Suction Fan
$ 2.25 ~ $ 4.5
>=1 Set
Meo Food Co., Ltd.
New Improved UV Insect Killer Lamp with Collection Tray Electric Bug Zapper model EGO-02-30W Pest Control Machine
$ 15.4
>=500 piec
Meo Food Co., Ltd.
USB rechargeable photocatalyst mosquito pest lamp/USB mosquito lamp electric shock/UV LED Electronic Mosquito Killer zapper
$ 3 ~ $ 6
>=100 Piece
Meo Food Co., Ltd.
Indoor USB Powered UV LED Electronic Waterproof Mosquito Killer
$ 0.65 ~ $ 1.2
>=10 piec
Meo Food Co., Ltd.
Hot Sale Factory Direct Free Pollution UV Light Fly Glue Trap MOSQUITOES TRAPS Insect Control >480 Hours Disposable 11-19 Pieces
$ 0.08 ~ $ 0.1
>=5000 piec
Meo Food Co., Ltd.
USB Electric Noiseless USB Powered Bugs Trap Lamp Electric Mosquito Killer
$ 12.27 ~ $ 13.62
>=2 piec
Meo Food Co., Ltd.
2020 New Insect Repeller Repellent Catalytic Attracts UV LED Electronic USB Powered Mosquito Killer Lamp
$ 1.82 ~ $ 2
>=50 piec
Meo Food Co., Ltd.
2020 new trap electronic indoor outdoor led anti-mosquito killer lamp
$ 1.5 ~ $ 2.9
>=2 piec
Meo Food Co., Ltd.
USB Powered Electronic Bug Zapper Mosquito Killer Lamp
$ 4.32
>=1 Piece
Meo Food Co., Ltd.
Laudtec New-tech Indoor Insect Trap Led Mosquito Killer Electric Mosquito killer Machine for Kids and Mother
$ 5.3 ~ $ 5.5
>=40 piec
Meo Food Co., Ltd.
Dropshipping USB Powered UV LED Photocatalyst Electric Bug Zapper Mosquito Killer Pest Control LED Light Trap Lamp
$ 2.79 ~ $ 3.29
>=100 piec
Meo Food Co., Ltd.
Aspectek Indoor UV LED Electrical Mosquito Killer Fly Pads For Trap Bug Zapper
$ 14.85 ~ $ 16.2
>=1 Piece
Meo Food Co., Ltd.
2020 Summer Hotsell Light Control Super Silent Usb Powered Electronic Mosquito Killer Non-Toxic Uv Led Mosquito Trap Lamp
$ 1.65 ~ $ 2.8
>=5 piec
Meo Food Co., Ltd.
Indoor Outdoor Mosquito Killer Fly Zappers Waterproof Compact Uv Insect Trap Lamp Bug Zapper
$ 2.36 ~ $ 2.99
>=5 piec
Meo Food Co., Ltd.
Electric Mosquito Insect Killer/ UV Bug Zapper with LED Trap Lamp for Indoor USB Repellent Anti Moustique Pest Control
$ 2.65 ~ $ 3
>=2 piec
Meo Food Co., Ltd.
Related Searches:
solarflyzapperbestelectricbugzapperbatteryoperatedmosquitokillerelectricflyracketcampingmosquitozapperhandheldflyzappergnatbugzapperflyswatterelectricracketportablemosquitozapperbestindoorbugzapper2018bestsolarpoweredbugzapperflowtronbk15ddiymosquitozapperbestportablebugzapperwaspswatterbugzappervoltagepestrejectzapperbugzappernzrechargeablemosquitokillerwallbugzapperindoorinsectzapperbugzapperprostingerbuglightbugzapperforfliesfruitflyzapperbestbuybugzapperbestindoormosquitozappersolarpoweredmosquitotrapinsectzapperracketelectricbugracket