Welcome to TradeChina
-
RELATED CATEGORIES:
Home use Non-washing Spray with anywhere Sterilization efficiency For all skin type Hand alcohol lotion
$ 380
>=30 boxe
Meo Food Co., Ltd.
SUNRICH CE ss methanol vertical storage tanks for cosmetic lotion cream hand sanitizer liquid soap detergent dishwashing alchol
$ -
>=1 Set
Meo Textile Clothing Co.LTD
WECARE Popular Street Snack Food Bbq Fry Display Freezer Ice Cream Hand Push Cart Trailer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2021 SUNRICH Best quality 1000L stainless steel storage tanks for cosmetic cream lotion shampoo liquid soap hand sanitizer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Custom logo nourishing hand cream set with nail file the best hand care set
$ 0.86 ~ $ 0.9
>=10000 piec
Meo Food Co., Ltd.
Home use Chemical free Grain alcohol Alkaline water Fast delivery to anywhere 100ml/500ml Multi type Hand alcohol lotion
$ 380
>=30 boxe
Meo Food Co., Ltd.
Easy potable water storage tank for cosmetic shampoo lotion cream liquid soap detergent hand sanitizer liquid fabric softner
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Best stainless steel coconut oil storage tank for cosmetic lotion cream shampoo liquid soap detergent shower gel hand sanitizer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Wash free Moisturizing hand Sterilization efficiency For all skin type Minimize irritative nature Multi type Hand alcohol lotion
$ 380
>=30 boxe
Meo Food Co., Ltd.
Best stainless steel storage tank 200000 liter ss storage tank for cosmetic lotion cream hand sanitizer dishwashing liquid soap
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High shear top quality liquid soap hand sanitizer dishwashing handwashing cream detergent shampoo emulsifying mixing mixer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory directly price of liquid soap hand sanitizer lotion detergent shampoo mixer with homogenizer and vacuum
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2021 New promotional best price liquid saop hand sanitizer detergent lotion cream dishwashing gel shampoo mixing machine line
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2021 Best quality CE car shampoo detergent liquid soap dishwashing lotion cream hand sanitizer hair shampoo machine mixer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
SUNRICH Hot sale best price customized 500L detergent dishwashing lotion cream hand sanitizer liquid soap and shampoo machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
SUNRICH 1000L stainless steel high shear feed perfume lip gloss shampoo liquid soap lotion cream hand sanitizer mixing machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2021 SUNRICH Factory directly best price liquid soap hand sanitizer shampoo cosmetic lotion cream vacuum mixing emulsifying pot
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CE Hydraulic tilting vacuum cosmetic emulsifying mixer for lotion face cream liquid soap hand sanitizer gel shampoo detergent
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Various applicants Free of irritating odor Removal of waste toxins Cost-effectiv Manufactured in Korea Hand alcohol lotion
$ 380
>=30 boxe
Meo Food Co., Ltd.
2021 CE liquid soap hand sanitizer gel detergent face cream lotion cosmetic vacuum emulsifier mixer Guangdong China manufactuer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
No harm for kids Home use pH suitable for human Travel size Fast shipping Manufactured in Korea Multi type Hand alcohol lotion
$ 380
>=30 boxe
Meo Food Co., Ltd.
Free of irritating odor Removal of waste toxins 60% Grain alcohol Wash free Remove harmful bacteria Ammonia smell Eco-friendly
$ 1
>=1 boxe
Meo Food Co., Ltd.
Factory price Home use Portable size pH suitable Eco-friendly multi type hand alcohol lotion Eco-friendly multi type hand alcoh
$ 1
>=1 boxe
Meo Food Co., Ltd.
New Concession Stand Trailer mini Mobile food cart design fryer Kitchen vintage restaurant turkey buy food truck car australia
$ -
>=1 Set
Meo Textile Clothing Co.LTD
No Rebounding From B to F Big Cup Real Plus Size Push Up Free Breast Enhancement Herbal Butt Enlargement Cream
$ 4 ~ $ 7
>=12 Piece
Meo Food Co., Ltd.
Mobile Concession food truck trailer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Private Label Redness Soothing Eczema Itch Nappy Diaper rash baby cream moisturizing whitening body lotion wholesale
$ 10 ~ $ 12
>=200 piec
Meo Food Co., Ltd.
left hand with light ice-cream blending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
energy saving used Food Steamer Cart Used Food Cart mobile food tuck ice cream truck for sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Foot Balm Healthy Feet Night Treatment Advanced Repair Cream Full Body Lotion for Dry Cracked Skin Callus Remover Foot Cream
$ 0.85 ~ $ 0.95
>=3 Piece
Meo Food Co., Ltd.
Hot sale PET Plastic Pill Capsule Shaped Pink Blue Cosmetic Spray Pump Bottles
$ 0.15 ~ $ 0.35
>=1000 piec
Meo household Co.LTD
CE ISO certification milkshake making machine with best price
$ 380 ~ $ 420
>=1 Set
Meo Textile Clothing Co.LTD
Best Callus Remover Moisturizes and Rehydrates Feet Knees Elbows Foot Lotion For Thick Cracked Rough Dead Dry Skin Foot Cream
$ 0.75 ~ $ 0.9
>=3 Piece
Meo Food Co., Ltd.
JYD Wholesale Pneumatic Semi-Auto One Head Fruit Pulp Filling Machine with Hand Trigger
$ 850 ~ $ 900
>=1 Set
Meo Textile Clothing Co.LTD
A03 Manual Paste Filling Machine or Handle Pressure cream filler factory price/honey/cream/paste/saurse
$ 85 ~ $ 95
>=1 Set
Meo Textile Clothing Co.LTD
OEM ODM baby cream Soothing Eczema Itch Nappy Diaper rash moisturizing whitening body lotion cream baby oil skin care series
$ 10 ~ $ 12
>=200 Piece
Meo Food Co., Ltd.
Foot Cream Moisturizing Relief Skin for Dry Cracked Heels Callused Feet Athletes Foot Best Therapeutic Miracle Heel Feet Lotion
$ 0.79 ~ $ 0.93
>=20 piec
Meo Food Co., Ltd.
Amber frosted 250ml bamboo pump cap body wash shower gel PET bottle shampoo lotion empty pakageing bottle
$ 1.35 ~ $ 1.42
>=50 piec
Meo household Co.LTD
mobile office van caravan sell ice cream
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Big Cup Real Plus Size Push Up Free Breast Enhancement Hips Butt Enlargement Breast Massage Firming Cream
$ 3 ~ $ 7
>=12 Piece
Meo Food Co., Ltd.
Best Face Serum, Serious Anti Aging for a Younger Glowing Skin, non greasy
$ 13.25 ~ $ 19.39
>=12 Unit
Meo Food Co., Ltd.
100ml Screw cap aluminum jars, lip balm aluminum tin can, round metal tin jar
$ 0.23 ~ $ 0.26
>=1 Piece
Meo household Co.LTD
Hand operated small scale bottling machine
$ 300
>=1 Set
Meo Textile Clothing Co.LTD
Protein Cookie Dough Metal Ice Cream Scoop
$ 1.68
>=1200 Piece
Meo Food Co., Ltd.
Breast Development Lifting Fast Push Up Big Sexy Breast Papaya Hips Butt Hip Enlargement Massage Cream
$ 3 ~ $ 7
>=12 Piece
Meo Food Co., Ltd.
Factory price baby cream Soothing Eczema Itch Nappy Diaper rash moisturizing whitening body lotion cream
$ 10 ~ $ 12
>=200 Piece
Meo Food Co., Ltd.
Japanese Hot Selling Instant Lifting Up Shape Up Big Breast Beauty Big Boobs Enlargement Bust Firming Cream
$ 4 ~ $ 7
>=12 Piece
Meo Food Co., Ltd.
TNG type Automatic Linear Type Viscous Liquid/Cream/Lotion/Cosmetic Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Wholesale Ceramic Tableware Pink Ice Cream Sauce Bowl Set with Tray
$ 1.5 ~ $ 11
>=200 Piece
Meo Food Co., Ltd.
Timer countrol gelato Hard serve ice cream batch freezer machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
victoriasecrethandlotionhandinhandbodylotioncoconuthandcreamhandbodycreamoriflamecrackedhandcreamhandlotionformenhempzhandcreambesthealinghandcreamureahandcreamamwayhandcreamarganhandcreamluxuryhandlotionallnaturalhandcreamgoodlotionfordryhandstop10handcreamshandcreamforcrackedhandseucerinhandlotionneutrogenahandcreamtargetrinjulotiongoodseedolivehandandbodylotionlotionfordryhandsbesthandcreamforextremelydryskinbarriercreamforhandsbesthandlotionforcrackedhandsvaselineintensivecareadvancedrepairhandcreamjomaloneorangeblossombodycreamhandcreamsalelotionforcrackedhandschappedhandscreamyvesrocherhandcream