Welcome to TradeChina
-
High-quality customized red luxurious table cloth wedding polyester matching table napkin
$ 1.5 ~ $ 6
>=1 Piece
Meo Food Co., Ltd.
Hot selling cheap pvc tablecloth disposable waterproof with custom design white table cloth
$ 0.25 ~ $ 0.28
>=5000 Piece
Meo Food Co., Ltd.
Professional Manufacture Cheap Waterproof Tablecloth Fancy Tablecloth Tablecloth Santa
$ 2 ~ $ 5
>=300 Piece
Meo Food Co., Ltd.
Wholesale Customized Banquet Tablecloth Lattice Lace Printed Tablecloth With Good Quality
$ 1
>=2000 Meter
Meo Food Co., Ltd.
white table cloth round tnt biodegradable disposable 108 inch round tablecloth
$ 1.9 ~ $ 2.5
>=1000 Kilogram
Meo Food Co., Ltd.
Wholesale Red and white Checkered Tablecloth Rectangle Washable Gingham Table Cloth for Outdoor Picnic with Napkins
$ 0.28 ~ $ 0.35
>=14400 Piece
Meo Food Co., Ltd.
JACQUARD Polyester Tablecloth with Cloth Napkins
$ 1 ~ $ 4
>=400 Piece
Meo Food Co., Ltd.
Tablecloths for tables of wedding in selling square tablecloths lace red wedding tablecloth rosette table overlay
$ 3 ~ $ 5
>=50 Piece
Meo Food Co., Ltd.
Wholesale 60x126Inch Red and white Checkered Tablecloth Rectangle Washable Gingham Table Cloth for Outdoor Picnic with Napkins
$ 3.54 ~ $ 4.25
>=10 piec
Meo Food Co., Ltd.
Lurex Elegant Polyester Tablecloth With 8 Napkins, In Gold Or Silver Made in Turkey tablecloth
$ 3.2 ~ $ 10.9
>=48 Piece
Meo Food Co., Ltd.
OEM Stone Washed linen Table linen and napkins 100%French Linen Table Cloth With Various sizes
$ 6.99 ~ $ 9.99
>=100 Piece
Meo Food Co., Ltd.
White Ivory Black Table Cloth Round Rectangle Square 100% Polyester Table Cloth Tablecloth for Wedding Party
$ 2.5 ~ $ 3
>=100 Piece
Meo Food Co., Ltd.
Yarn dyed jacquard damask cotton tablecloth with napkin or fabric for hotel home
$ 4.28 ~ $ 4.5
>=300 Piece
Meo Food Co., Ltd.
High quality wholesale polyester fabric plain navy blue cloth table napkin
$ 0.17 ~ $ 0.2
>=500 Piece
Meo Food Co., Ltd.
Light Teal Indian Natural Linen Napkins Kitchen Dinner Table Placemats
$ 0.5 ~ $ 2
>=1 Piece
Meo Food Co., Ltd.
wall mount kitchen garbage dispenser plastic grocery bag holder
$ 0.25 ~ $ 1.2
>=2000 Meter
Meo Food Co., Ltd.
free sample wedding sequence hotel round napkins and tablecloth
$ 1.99 ~ $ 7.19
>=100 square meter
Meo Food Co., Ltd.
Taitang Restaurant Linen Pink Outdoor Wedding Banquet Elegant Tablecloths Round Table Cloth Polyester
$ 17.99 ~ $ 24.99
>=50 Piece
Meo Food Co., Ltd.
Blue gold deer head square waterproof art tablecloth, 100% polyester table cloth water proof rectangle woven digital printed
$ 2.21 ~ $ 4.6
>=2 Piece
Meo Food Co., Ltd.
Rectangular luxury 100% Flax Grey Stonewashed Natural linen Table Cloth For Wedding as a gift set
$ 20.55 ~ $ 24
>=10 Set
Meo Food Co., Ltd.
elegant 120 round wedding white tablecloth
$ 6 ~ $ 12
>=50 Piece
Meo Food Co., Ltd.
Wholesale Logo Tablecloths Napkin Wedding Cover For Multi Fold Dining Fitted Covers Business Country Drapes Cloths
$ 29
>=1 piec
Meo Food Co., Ltd.
2015 New Design Office PVC Table Cloth with oilcloth fabric
$ 0.3 ~ $ 1.5
>=2000 Meter
Meo Food Co., Ltd.
Restaurant Tablecloths And Napkins Cocktail Coloring Rainbow Christmas Tablecloth
$ 1.7 ~ $ 1.9
>=2000 Meter
Meo Food Co., Ltd.
European style Tablecloths, table runners, napkins Jacquard fabric dining table cloth
$ 0.5 ~ $ 30
>=50 Piece
Meo Food Co., Ltd.
2020 New Design durable popular fashionable napkin custom table cloth
$ 4.4 ~ $ 4.6
>=100 Piece
Meo Food Co., Ltd.
Made In China White Paper Napkins Woodpulp Paper Tablecloth
$ 0.01 ~ $ 0.08
>=10000 Piece
Meo Food Co., Ltd.
Wholesale Christmas tablecloth for new year, Pure Linen fabric, size 170x260 cm. Include Table cloth and 12 pcs napkin
$ 35 ~ $ 40
>=10 Piece
Meo Food Co., Ltd.
Luxury Damask Fabric Tablecloth 100% Polyester Soil Resistant Dining Room, Party Banquet and Holiday Tablecloth
$ 3 ~ $ 10
>=500 Piece
Meo Food Co., Ltd.
Plain white cotton round tablecloths and napkins
$ 16.9 ~ $ 16.95
>=100 piec
Meo Food Co., Ltd.
High Quality 100% Cotton Textured Fabric Napkin,tablecloth
$ 0.3 ~ $ 0.7
>=1000 Piece
Meo Food Co., Ltd.
restaurant round table clothes 20 meters party tnt telas printed nonwoven runner custom logo christmas disposable table cloth
$ 1.9 ~ $ 2.5
>=1000 Kilogram
Meo Food Co., Ltd.
Custom 100% flax linen table cloth embroidery napkin 45x45cm for dinner table
$ 1.23 ~ $ 2.45
>=100 Piece
Meo Food Co., Ltd.
100% nature flax stripes linen striped table runner napkin placemats tablecloths set
$ 2 ~ $ 40
>=20 Piece
Meo Food Co., Ltd.
Wholesale Wedding Table Linens/100% French Linen Tablecloth Runner Napkins
$ 11.89 ~ $ 29.89
>=20 Piece
Meo Food Co., Ltd.
tablecloth oval wedding table overlay cloth round embroidery napkins
$ 3.5 ~ $ 4
>=10 piec
Meo Food Co., Ltd.
Cutwork table cloth
$ 2.99 ~ $ 3.99
>=100 Piece
Meo Food Co., Ltd.
100% cotton printed round table cloth and Napkin
$ 12 ~ $ 13
>=200 Piece
Meo Food Co., Ltd.
2021 Promotion Weeding Jacquard Lace Banquet Restaurant Home Party Rectangular Cotton Polyester Custom Church Table Cloth
$ 6.6 ~ $ 7.3
>=5 Piece
Meo Food Co., Ltd.
KAUKKO Christmas Home Kitchen Thickening to Increase Fabric West Napkin Placemat Tablecloth
$ 1.5 ~ $ 6.7
>=20 Piece
Meo Food Co., Ltd.
Round polyester damask emerald green tablecloth party
$ 0.35 ~ $ 7.5
>=1 Piece
Meo Food Co., Ltd.
High Quality Black shiny Sequin Round Table Cloth For Wedding Events party Banquet Table Decoration Table Overlay
$ 1 ~ $ 26
>=10 Piece
Meo Food Co., Ltd.
Table Runner Cover Flax Napkin Tablecloth Table Linen Set For Kitchen Dining Room Decor
$ 30
>=100 piec
Meo Food Co., Ltd.
Waterproof Luxury Restaurant And Napkin Polyester Tablecloth Fabric
$ 1.5 ~ $ 9
>=500 Piece
Meo Food Co., Ltd.
Rectangular Party Table Cloths Napkins Plaid Rural Polyester Tartan Design Table Runner Picnic Cloth for Kitchen Home
$ 0.8 ~ $ 0.83
>=1300 Meter
Meo Food Co., Ltd.
Vietnamese embroidery napkins luxury for party in everone
$ 30 ~ $ 80
>=50 Piece
Meo Food Co., Ltd.
Luxury Hotel Table Linen And Napkin Wedding Manufacturers China
$ 10.99
>=100 Piece
Meo Food Co., Ltd.
Birthday Party Supplies tablecloth white in Table Cloth with square napkins skirt lace champagne tablecloth
$ 1.22 ~ $ 30
>=5 Piece
Meo Food Co., Ltd.
High Quality Reusable Waterproof Party Printed Colorful Checked Pattern Western Pvc Table Cloth
$ 1.65 ~ $ 1.74
>=2 Piece
Meo Food Co., Ltd.
Brand New Tartan Tablecloth With Ce Certificate
$ 6.62 ~ $ 13.01
>=1 Piece
Meo Food Co., Ltd.
Related Searches:
tablenapkinsforsalefoldingclothnapkinswithringsmustardyellowclothnapkinspapernapkintablesettingtablenapkinclothtypenavybluetablenapkinstablesettingwithnapkinringstablenapkin20x20blackplacematsandnapkinsdiningtablenapkinfoldingcobaltblueclothnapkinsbeigeclothnapkinsblushtablenapkins10easynapkinfoldingfalltablenapkinsdamaskclothnapkinsbesttablenapkinsfancytablenapkinfoldingeasytablenapkinfoldingstepbysteppapertableclothsandnapkinsmonogrammedtablenapkinstanclothnapkinsredandwhitecheckeredclothnapkinspaisleyclothnapkinsbeautifulclothnapkinschristmasclothnapkinsbabyblueclothnapkinsgreyserviettesnapkinfoldingwithringholderpurpletablenapkins