Welcome to TradeChina
-
Biodegradable weave Rattan wheat straw portable double wall Plastic unbreakable rattan Glass water bottle with sleeve
$ 0.98 ~ $ 1.59
>=2 Piece
Meo Food Co., Ltd.
Amazon Hot Sale Big Capacity Gym Shaker Cup New Sports Protein Powder Speed Shaker Bottle
$ 2.5 ~ $ 3.2
>=100 Set
Meo Food Co., Ltd.
Biodegradable Rattan Wheat Straw Sleeve Double Wall Glass water Bottle with sleeve
$ 0.85 ~ $ 1.35
>=20 Piece
Meo Food Co., Ltd.
Logo Print 2020 new trending products frosted color small mouth 2.2L gym sport water jug with weave handle
$ 2.29 ~ $ 2.99
>=500 Piece
Meo Food Co., Ltd.
Salon Hair Color Dispenser Brush Hair Dyeing Tint Comb with Bottle 100ml Hair Color Applicator Bottle with Comb
$ 0.22 ~ $ 0.4
>=2 Piece
Meo Food Co., Ltd.
Wide Mouth Flask Sport Drink Bottle Cap For All Size Vacuum Insulated Bottle
$ 0.75 ~ $ 6
>=100 piec
Meo household Co.LTD
Water plastic bottle 400T shell fabric recycled taffeta
$ 1.1 ~ $ 1.24
>=100 Yard
Meo Electronic Technology Co.LTD
Zogift Unique Design Biodegradable plastic Rattan Weaving 310ml Glass Water Bottle
$ 0.5 ~ $ 3.2
>=1 Piece
Meo Food Co., Ltd.
Free shipping handmade weave paracord bottle handle with carabiner and safety ring for wide mouth bottle
$ 1.78 ~ $ 3.08
>=10 Piece
Meo Electronic Technology Co.LTD
Custom Your Own Brand Coconut Oil Hair Foaming Pump Bottle For Hair Mousse
$ 1.15 ~ $ 1.8
>=480 Piece
Meo Food Co., Ltd.
high woven label weaving machine and Polyester tape cutting machine
$ 630 ~ $ 650
>=1 Set
Meo Textile Clothing Co.LTD
RPET recycled polyester spun regenerated yarn from plastic bottle
$ 4.1 ~ $ 5
>=1000 Kilogram
Meo Electronic Technology Co.LTD
Wholesale Cute Self Defence Defense Police Mini 20Ml Keychain For Women Sale Holder Bottles Bulk gas pimienta
$ 2.72 ~ $ 2.8
>=20 Piece
Meo Food Co., Ltd.
Eco-friendly/recycled polyester/RPET/plastic bottle/recycled PET taffeta fabric
$ 0.27
>=50000 Meter
Meo Electronic Technology Co.LTD
Factory Price recycle recycled 75D dty textured polyester pet bottle sock filament yarn with grs certificate for knitting
$ 3.65 ~ $ 3.87
>=2 Kilogram
Meo Electronic Technology Co.LTD
Wholesale Private Label Hair Wax Stick for Hair Smooth with Plastic Bottle
$ 1.45 ~ $ 1.8
>=1 Piece
Meo Food Co., Ltd.
Shandong factory price plastic crusher plastic PE,PP,PS,PVC,ABS bottle weaving bag film crusher
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Peach Skin Suede Shrink-resistant Polyester Fleece Ocean Recycle Recycled Pet Bottle Fabric
$ 1.5 ~ $ 4.6
>=1 Meter
Homelife
custom design double side print microfiber waffle plastic bottle recycled beach towel
$ 5.85 ~ $ 6.56
>=100 piec
Meo Food Co., Ltd.
Regenerated recycled plastic bottles pet polyester GRS yarn
$ 2 ~ $ 2.5
>=4000 Kilogram
Meo Electronic Technology Co.LTD
Silver Black PP Material Rear Bottle Diffuser for Chevy Cruze
$ 25 ~ $ 60
>=1 Piece
Meo Bio Energy Sales Co.LTD
Buy large big pre-tied designer wine bottle decorative gold ribbon bowsfor decoration
$ 0.4 ~ $ 0.8
>=500 Piece
Meo Electronic Technology Co.LTD
OEM Bottle Mens Hair Product Eco Styling Gel Pomade Edge Control Vendor
$ 1.6 ~ $ 1.75
>=2 Piece
Meo Food Co., Ltd.
2020 Regenerated recycled plastic bottles pet polyester GRS yarn
$ 1 ~ $ 2.2
>=1000 Kilogram
Meo Electronic Technology Co.LTD
Organic hair wax vendor edge tamer hair styling products for natural hair 4 oz braid gel make your own label
$ 1.6 ~ $ 2.9
>=100 Carton(s)
Meo Food Co., Ltd.
Hair beauty Matte natural hair mousse private label 200 ml plastic bottle softer cleaning hair mousse
$ 1.99 ~ $ 2.99
>=500 piec
Meo Food Co., Ltd.
Eco-friendly Recycled T Shirts Leggings Made From Recycled Plastic Bottles Rpet Repreve Pet Polyester Fabric
$ 3 ~ $ 4
>=1000 Kilogram
Meo Electronic Technology Co.LTD
Related Searches:
recycledplasticweavingsmallplasticbottlecraftplasticcanvasanimalsplasticbottleweavingusingyarndiybirdfeederplasticbottlecraftpaintforplasticplasticcanvasstitchesembroideryonplasticdiykeychainplasticplasticboxcraftplasticcanvasforbeginnersplasticcanvasbucillaplasticcanvasplasticlacingcordrecycledplasticartprojectsplasticcanvaschristmasplasticbottlebirdfeedercraftpvcpipekidprojectschristmascraftswithplasticcupscraftstringplasticplasticcanvascraftsplasticcrossstitchwaterbottlecraftsforpreschoolplasticlacecraftsplasticcanvasbytheyardplasticsandartbottleswithcorkplasticbagdiycraftsdiyplasticbottleartmeltedplasticcraftsplasticcrochet