Welcome to TradeChina
-
GS208 mini pet preform plastic cup injection molding machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High quality pet preform injection plastic machine pet preform making machine injection moulding machine
$ -
>=1 Acre(s)
Meo Textile Clothing Co.LTD
Empty fine mist PET 30ml 50ml 100ml 120ml 150ml 200ml 250ml 500ml amber white clear plastic spray bottle for cosmetic packaging
$ 0.03 ~ $ 0.17
>=100 piec
Meo household Co.LTD
5ml-500ml HDPE and PET Empty White and Clear Perfume Refillable Plastic Spray Bottles with Fine Mist Sprayer Pump
$ 0.1 ~ $ 0.35
>=1 Piece
Meo household Co.LTD
100ml PET Plastic Round, spice jar with butterfly cap/
$ 0.14 ~ $ 0.33
>=3000 piec
Meo household Co.LTD
From China Plastic E Liquide Pet 30ml V3 Shape E Liquid Vape Pen Bottle
$ 0.06 ~ $ 0.08
>=1000 piec
Meo household Co.LTD
250g 280g 350g 400g 500g 600g 1000g PET plastic jars containers for lotion cream foods with screw cap
$ 0.8
>=5000 Piece
Meo household Co.LTD
200ml Plastic PET Flat Square Mouthwash Bottle
$ 0.14 ~ $ 0.15
>=20000 Piece
Meo household Co.LTD
Mouthwash Bottle Gargle Liquid Packaging PET Plastic Wholesale Customization
$ 0.29
>=5000 piec
Meo household Co.LTD
Eco Friendly 300ml 500ml Disposable Packaging Custom Wholesale Fancy Empty Square Clear Use PET Plastic Juice Bottle
$ 0.09 ~ $ 0.14
>=10000 Piece
Meo household Co.LTD
High quality transparent vacuum PET plastic spray bottles can be printed and labeled
$ 0.06
>=10000 piec
Meo household Co.LTD
PET plastic Dropper Bottle with Dripper Tip for ejuice 30ml 60ml 100ml 120ml
$ 0.04 ~ $ 0.19
>=1000 Piece
Meo household Co.LTD
New style 250ml pet plastic square shaped empty lotion cosmetic bottles with flip cap
$ 0.12 ~ $ 0.5
>=100 Piece
Meo household Co.LTD
wide mouth 500ml custom logo clear PET plastic for protein softgel royal jelly supplement medicine bottle
$ 0.93
>=10000 piec
Meo household Co.LTD
250ml army green moisturizing emulsion shampoo PET plastic bottle with screw cap or pump
$ 0.15
>=1 Piece
Meo household Co.LTD
Trade assurannce 50ml 80ml PET plastic empty bottle with lotion pump for sale spray cosmetic bottles
$ 0.2 ~ $ 0.7
>=100 Piece
Meo household Co.LTD
Pharmaceutical 1oz 30ml PET Plastic clear effervescent tablet Bottle with silica gel desiccant cap
$ 0.08 ~ $ 0.09
>=10000 piec
Meo household Co.LTD
wholesale empty round amber black 200ml cosmetic pet plastic jar with cap
$ 0.49 ~ $ 0.53
>=50 piec
Meo household Co.LTD
Factory direct sales 300ml Cosmetic High Quality PET Plastic Pump Bottle with PP Pump Cap for Lotion and Shampoo
$ 0.27 ~ $ 0.43
>=500 piec
Meo household Co.LTD
IBELONG high quality 10ml green amber clear blue round pet plastic bottle with aluminium metal screw lid cap
$ 0.06 ~ $ 0.11
>=100 Piece
Meo household Co.LTD
Manufacture Multiple Styles PET Plastic Mouthwash Bottle
$ 0.11 ~ $ 0.26
>=1 Piece
Meo household Co.LTD
300ml 10 oz pink emulsion body lotion PET plastic bottle with double wall screw cap
$ 0.15
>=1 Piece
Meo household Co.LTD
50ml 60ml 80ml 100ml 120ml Empty Tattoo Ink Pigment Clear PET Plastic squeezable hair growth oil Bottle with Twist Cap
$ 0.25 ~ $ 0.34
>=100 piec
Meo household Co.LTD
Matte lotion toner spray PET plastic bottles set
$ 0.35 ~ $ 0.45
>=10000 Piece
Meo household Co.LTD
225cc plastic bottle for capsules, pet plastic medicine bottle with golden cap, green plastic bottle
$ 0.2
>=3000 piec
Meo household Co.LTD
Hot sale 250ml 500ml 750ml 1000ml amber tawny clear color PET plastic cooking edible olive oil bottles
$ 0.28 ~ $ 0.35
>=2926 Piece
Meo household Co.LTD
pet plastic type 50ml plastic roll on deodorant empty bottle with plastic roller ball
$ 0.1 ~ $ 0.3
>=100 Piece
Meo household Co.LTD
Wholesale Stock Product Empty 250ml Cosmetic Clear PET Plastic Facial Toner Mist Spray Bottle
$ 0.43 ~ $ 0.47
>=10 piec
Meo household Co.LTD
round white 300ml PET plastic medicine pill bottle with tear off cap
$ 0.09 ~ $ 0.3
>=10000 Piece
Meo household Co.LTD
Cosmetic facial cleanser 30ml 50ml 60ml 100ml clear white PET plastic mousse foam pump bottle
$ 0.6 ~ $ 0.65
>=5 Piece
Meo household Co.LTD
50pcs/lot 50ml PET colored plastic cosmetic fine mist spray bottles empty continuous spray mist bottle with fine mist sprayer
$ 0.15 ~ $ 0.2
>=50 piec
Meo household Co.LTD
50ml 100ml 150ml 200ml dark green PET plastic refill perfume atomizer spray bottle
$ 0.15 ~ $ 0.55
>=100 Piece
Meo household Co.LTD
wholesale 5ml10ml20ml30ml50ml-100ml 250ml Sharp mouth PET plastic oil bottle/ink/sauce squeeze/glue bottle eye drops bottle
$ 0.02 ~ $ 0.06
>=3000 Piece
Meo household Co.LTD
High Quality Shower Gel Shampoo Hand Sanitizer Packaging 500ml Clear PET Plastic Bottle
$ 0.3 ~ $ 0.5
>=10000 Piece
Meo household Co.LTD
Long neck 1000ml plastic with metal cover transparent 1Liter olive oil pet plastic packaging bottle
$ 0.33 ~ $ 0.4
>=1980 piec
Meo household Co.LTD
100ml clear flat shoulder pet plastic round bottle for oil from GuangZhou manufactory
$ 0.13 ~ $ 0.5
>=3 piec
Meo household Co.LTD
Cheap Discount Pet Plastic Empty Bottle Shower Gel 50ml,150ml,250ml,500ml, Cat And Dog Shampoo Bottle
$ 0.76 ~ $ 1.98
>=1000 Piece
Meo household Co.LTD
250ml clear pet plastic trigger spray bottle for cleaning windows
$ 0.45
>=500 piec
Meo household Co.LTD
cheap price in stock10ml PET plastic e juice liquid dropper bottles for e vape e liquid oil with tamperproof cap
$ 0.03 ~ $ 0.13
>=100 Piece
Meo household Co.LTD
New design 1000ml 1L clear empty liquid soap PET plastic bottles
$ 0.1 ~ $ 0.4
>=10000 Unit
Meo household Co.LTD
500ml pet plastic Screen Printing Surface Handling shampoo bottle packaging
$ 0.11 ~ $ 0.21
>=10000 Piece
Meo household Co.LTD
1L PET plastic round disposable custom hot filling juice bottle
$ 0.15 ~ $ 0.16
>=5000 piec
Meo household Co.LTD
30ml 60ml 120ml clear Pet plastic e liquid dropper bottle with childproof tamper evident cap
$ 0.06 ~ $ 0.1
>=1000 Piece
Meo household Co.LTD
Wholesale Empty 200Ml 300Ml 500Ml Frosted Clear Pet Plastic Wide Mouth Cream Pcr Jar Big Size Facial Mask Or Hair Mask Container
$ 0.45 ~ $ 0.7
>=10000 Piece
Meo household Co.LTD
300ml PET Plastic Empty Hand Sanitizer Transparent Bottle with Spray Rotary Pump Head Gel Hand Sanitizer Bottle
$ 0.16 ~ $ 0.26
>=5000 piec
Meo Bio Energy Sales Co.LTD
Food Grade 320ml PET Plastic Containers Plastic Jars for Peanut Butter Honey Jams
$ 0.19 ~ $ 0.24
>=1000 piec
Meo household Co.LTD
Round PET Clear Plastic Bottles With Aluminium Screw Cap
$ 0.2
>=5000 piec
Meo household Co.LTD
Empty Square Biodegradable PET Plastic Personalized shower gel Hotel Skin Care Lotion Pump Hair Shampoo Bottle
$ 0.01 ~ $ 0.1
>=10000 Piece
Meo household Co.LTD
50ml 6832mm pop juice plastic pet transparent tin can food jar pet with screw lid
$ 0.25 ~ $ 0.42
>=1 piec
Meo household Co.LTD
White or Customized PET Plastic Empty Hand Sanitizer Bottle With Flip Top Cap for cosmetics
$ 0.05
>=2000 Piece
Meo household Co.LTD
Related Searches:
petplasticbottlesplasticbottlerecyclingplantrecycle2recycledplasticsheets8x4petbottleflakespetscraprecycledplasticmanufacturersplasticrecyclingcompaniesplasticscraprecyclingcompaniesplasticrecyclingcompaniesnearmeldpe4plasticabsrecyclingshreddedplasticrecyclingwaterbottlesformoneyrecycleziplocbagssingleuseplasticrecyclingcrushedplasticbottleplasticdisposalrecycledplastic4x8sheetsrecycledplasticpelletsplasticthatcanberecycledrecyclingplasticplantpotspetbottlecrushingbusinesshdpe2recyclingpcrrecyclingplasticcollectionpetflakespricerecycle5plasticpreciousplasticrecyclingplantcost