Welcome to TradeChina
-
Best Quality Brass Copper Fuel Dispenser Valve Brass Triangle Flange Valve One Way Check Valve
$ 5 ~ $ 6
>=10 Piece
Meo Bio Energy Sales Co.LTD
12204-74030 PCV Valve for Toyota Camry RAV4 Automotive professional Fuel Non Return Check Valve One Way spare parts
$ 1 ~ $ 3.68
>=50 Piece
Meo Bio Energy Sales Co.LTD
PQY STORE-1/4" 6mm Non Return One Way Fuel Check Valve Aluminum Alloy Petrol Diesel PQY-FCV06
$ 2.56 ~ $ 2.69
>=1 Piece
Meo Bio Energy Sales Co.LTD
Top Quality China Car Spare Parts Aluminum 6MM 8MM 10MM 12MM Gasoline Diesel Fuel One-way Check Valve
$ 1.11 ~ $ 1.41
>=50 piec
Meo Bio Energy Sales Co.LTD
6mm 8mm 10mm 12mm Aluminum Alloy Non Return One Way Check Valve Fuel Line Check Valve Petrol Diesel Marine Water
$ 0.99 ~ $ 1.12
>=100 Piece
Meo Bio Energy Sales Co.LTD
Triangle One Way Check Valve China Manufacturer Best Quality Brass Copper Fuel Dispenser Valve Brass Triangle Flange Valve
$ 5 ~ $ 6
>=10 Piece
Meo Bio Energy Sales Co.LTD
exhaust system One Way 6 8 10 12mm 4 Size Valves Aluminium Alloy Fuel Non Return Check Valve One Way Fit Carburettor
$ 1 ~ $ 2
>=100 Piece
Meo Bio Energy Sales Co.LTD
New 10mm 3/8" Fuel Non Return One Way Check Valve Petrol Diesel Aluminium Alloy
$ 2.9 ~ $ 3.5
>=30 Piece
Meo Bio Energy Sales Co.LTD
8mm Black Rubber Gas Petrol Fuel Line Pump Hand Primer Bulb for Car Boat
$ 1.93 ~ $ 2.55
>=100 Piece
Meo Bio Energy Sales Co.LTD
8mm Fuel Pumps Pipe Assembly Rubber Aluminum Hand Primer Bulb For Car Boat Marine Outboard Auto Fuel Pump
$ 3 ~ $ 3.96
>=100 Piece
Meo Bio Energy Sales Co.LTD
Rubber Fuel Pump Hand Primer Bulb One Way Valve for Marine Boat
$ 1
>=1000 Piece
Meo household Co.LTD
Custom High Quality Aluminium Alloy Fuel Non Return Check Valve One Way Valve For Fuel Hose Line
$ 1.25 ~ $ 1.35
>=1 Piece
Meo Bio Energy Sales Co.LTD
Aluminum 8mm 5/16" Fuel Non Return One Way Check Valve
$ 2.8 ~ $ 3.3
>=50 Piece
Meo Bio Energy Sales Co.LTD
1/4" Aluminium One Way Non Return Fuel Check Valve Aluminium Fuel Check Valve 1000F8
$ 1 ~ $ 9
>=100 Piece
Meo Bio Energy Sales Co.LTD
6/8/10/12mm Fuel Non Return Petrol Diesel Aluminium Alloy One Way Check Valve
$ 0.8 ~ $ 2
>=100 Piece
Meo Bio Energy Sales Co.LTD
8mm 5/16" Fuel Non Return One Way Check Valve Petrol Diesel Aluminium Alloy
$ 0.1 ~ $ 10
>=1 Piece
Meo Bio Energy Sales Co.LTD
One Way Silicone Rubber Duckbill Flap Check Valve Fuel Oil Tank Vent Plug For Stihl 017 018 MS170 MS180 MS 170 MS 180 Chainsaw
$ 0.06 ~ $ 0.07
>=10 Piece
Meo Textile Clothing Co.LTD
Fuel Tanker Pneumatic Ball Valve
$ 120 ~ $ 168
>=1 Piece
Meo Bio Energy Sales Co.LTD
6/8/10/12mm Aluminium Alloy Fuel One-way Non Return Check Valve Garden Irrigation Aquarium Connector
$ 1.2 ~ $ 1.3
>=100 Piece
Meo Food Co., Ltd.
Fuel combustion chamber multi-function vehicle multi-in-one detaching-free cleaning machine inlet valve ternary catalytic decarb
$ 300 ~ $ 350
>=1 Piece
Meo Bio Energy Sales Co.LTD
Fuel Hand Pump check valve Primer Bulb One Way Valve for Marine Boat
$ 0.9 ~ $ 1.2
>=100 Piece
Meo household Co.LTD
6 8 10 12MM Aluminium Chrome Alloy Fuel Non Return Check Valve One Way Non-Return Valve Petrol For Diesel OEM:1000F8
$ 1 ~ $ 3
>=100 Piece
Meo Bio Energy Sales Co.LTD
10MM & 12MM ALUMINUM FUEL NON RETURN CHECK VALVE
$ 3
>=100 Piece
Meo Bio Energy Sales Co.LTD
ID6 ID8 plastic black non return check one way valve fuel hose line quick connector hose adapter
$ 0.25 ~ $ 0.5
>=1 Piece
Meo Bio Energy Sales Co.LTD
LandSky Yacht outboard oil tank one-way valve manual pump rubber tube hand oil pump car fuel pipe pumping unit suction pipe
$ 4
>=50 Piece
Meo Bio Energy Sales Co.LTD
Manual Fuel Pump Rubber Aluminum Fuel Line Oil Transfer Tube Hand Primer Petrol Pump with PVC Hose
$ 2.69 ~ $ 3.4
>=100 Piece
Meo Bio Energy Sales Co.LTD
Rubber silicone Fuel Pump Hand Primer Bulb One Way Valve for Dilute acid and alkali resistance
$ 1 ~ $ 2
>=100 Piece
Meo household Co.LTD
Universal Manual Fuel Pump with PVC pipe Water oil Transfer Pump Petrol Diesel Hand Primer Bulb for Car Marine Outboard 8mm/10mm
$ 2.69 ~ $ 3.4
>=100 Piece
Meo Bio Energy Sales Co.LTD
Nice Rubber8mm12mm One Way No Return Bulb Hand Pump For Fuel Filter Replacement
$ 1
>=1000 Piece
Meo household Co.LTD
One way medical fuel mini air control non return One Way Check custom design medical silicone valve
$ 0.01 ~ $ 0.06
>=1000 Piece
Meo household Co.LTD
3/8 10mm Fuel Hand Pump long check valve Aluminium Alloy Diesel Non-return One Way Check Valve
$ 0.85 ~ $ 1.2
>=100 Piece
Meo household Co.LTD
-4AN AN4 AN-4 Fuel Non Return One Way Check Valve Petrol Diesel Aluminium Silver/Purple/Golden/Red/Blue/Black
$ 0.1 ~ $ 10
>=1 Piece
Meo Bio Energy Sales Co.LTD
Rubber silicone Fuel Pump Hand Primer Bulb One Way Valve for Alcohol and desinfection agents
$ 1 ~ $ 2
>=100 Piece
Meo household Co.LTD
Food grade one way mini fuel silicone rubber non return medical duckbill check valve factory
$ 0.01 ~ $ 0.1
>=1000 Piece
Meo household Co.LTD
3/8 10mm One Way Valve Fuel Pump Line Hose Hand Primer Bulb for Car Marine Boat Diesel
$ 1.5 ~ $ 1.8
>=1 Piece
Meo household Co.LTD
One Way Valve Line Hose Rubber Primer Bulb Engine Hand Fuel Pump Diesel For Boat Outboard Car Marine Petrol Tank Connectors
$ 1.4 ~ $ 1.6
>=100 Piece
Meo household Co.LTD
8mm One Way Valve Fuel Petrol Pump Line Hose Hand Primer Bulb Used For Cars Ship Boat Marine
$ 1.4 ~ $ 1.6
>=100 Piece
Meo household Co.LTD
6mm One Way Valve Fuel Petrol Pump Line Hose Hand Primer Bulb for Car Marine Boat Diesel
$ 1.4 ~ $ 1.6
>=100 Piece
Meo household Co.LTD
3/8 One Way Valve Fuel Pump Line Hose Hand Primer Bulb for Car Marine Boat Diesel
$ 1.4 ~ $ 1.6
>=100 Piece
Meo household Co.LTD
custom silicone rubber duckbill umbrella valve with Dia:20mm&13mm&11mm&10mm&8mm&7mm available
$ 0.01 ~ $ 0.05
>=1000 Piece
Meo household Co.LTD
4 Size Hand Siphon Pump Hose fuel Rubber Hand Primer Pump Bulb Type Boat and motorcycle Pump
$ 1.5 ~ $ 1.8
>=1 Piece
Meo household Co.LTD
Factory directly supply diesel fuel hand pump for for Car Marine Boat Diesel
$ 1 ~ $ 3
>=500 Piece
Meo household Co.LTD
Gas/Oil/Water/Fuel Transfer Siphon Pump,Gasoline Siphone Hose,Fuel Transfer Pump with 2 Eco-Friendly Hose (15mm)
$ 1.85 ~ $ 2.65
>=50 piec
Meo household Co.LTD
10mm OD Premium fuel Rubber Hand Primer Pump Bulb For Priming Diesel Engines On Cars
$ 1.2 ~ $ 1.5
>=50 Piece
Meo household Co.LTD
Automobile hand pump vehicle hand pinch pump one-way check valve hand pump
$ 1.1 ~ $ 1.23
>=1000 Piece
Meo household Co.LTD
Automatic pressurized primer car municipal road construction spraying bottom oil car hand push hot melt marking machine direct s
$ 568 ~ $ 610
>=1 Case(s)
Meo Textile Clothing Co.LTD
Related Searches:
singlecheckvalve15mmejectorpumpcheckvalvereliablecheckvalvecicheckvalvedoublenonreturnvalvequarterinchcheckvalve1psicheckvalvedoublecheckbackflowpreventerdisccheckvalvehighpressurenonreturnvalveaircompressorcheckvalveinlinenonreturnvalvecheckwaferdanielcheckvalvepvcwafercheckvalveintegralcheckvalvehotwaterheateroutletcheckvalvecpvcnonreturnvalve3inchpvccheckvalvefuelinjectioncheckvalvejandycheckvalvehydrauliccylindercheckvalveawwac508onewayairvalvecheckvalvesforwaterhotwaternonreturnvalvealarmvalvetycoclearcheckvalve1swingcheckvalveapi6dcheckvalve