Welcome to TradeChina
-
Natural No Irritation Sweet Honey Eyelash Extension Foam Cleanser with Oil Free foam cleanser bottle eyelash shampoo
$ 1.5 ~ $ 1.54
>=100 boxe
Meo Food Co., Ltd.
Wholesale Amino Acid Color Bean Anti acne Foaming Face Pore Cleanser Oil Control Facial Cleanser
$ 2.58 ~ $ 4.28
>=3 Set
Meo Food Co., Ltd.
Private Label Oem Oil Free Facial Cleanser Anti Acne Organic Amino Acid Face Wash for All Skin
$ 0.68 ~ $ 2.85
>=10 Piece
Meo Food Co., Ltd.
Private Label OEM LOGO Oil Free Cleanser Eyelash Shampoo Lash Foaming Cleanser for Eyelash Extension eyelash cleanser
$ 3.5
>=1 Piece
Meo Food Co., Ltd.
Best Selling Men face wash Oil Control Facial Washing Cleanser Charcoal Facial Cleanser
$ 0.78 ~ $ 1.2
>=2 Piece
Meo Food Co., Ltd.
Mountain Sea A1 Organic Argan Oil organic foam face wash private label welcome Amino acid facial cleanser
$ 2.85 ~ $ 5
>=48 Piece
Meo Food Co., Ltd.
Private label natural organic face wash deep cleansing refreshing shea butter cleanser oil free
$ 1.3 ~ $ 1.5
>=8 piec
Meo Food Co., Ltd.
Anti Acne Soothing Natural Moisturizing Oil Free Face Wash With Amino Acid Antioxidant Protection Facial Pore Cleanser Facial
$ 5.54 ~ $ 9.69
>=2 boxe
Meo Food Co., Ltd.
OBM Skin Care Moisturizing Elastic Foam Horse Oil Face Wash Facial Cleanser
$ 176.64 ~ $ 220.8
>=20 Case(s)
Meo Food Co., Ltd.
Customized Logo Moisturizing Tumeric Best For Oily Skin Vitamin C Face Wash
$ 2.1 ~ $ 5
>=2 Piece
Meo Food Co., Ltd.
Lash Foam eyelash extension cleansing bubble foam 50ml lash cleanser with soft brush Cleanser Eyelash Cleanser
$ 2.2 ~ $ 2.7
>=2 boxe
Meo Food Co., Ltd.
Menior amino acids volcanic mud cleanser face washing bean 56pcs OEM
$ 2.5 ~ $ 4.5
>=1 boxe
Meo Food Co., Ltd.
OEM/ODM private label deep cleansing face cleanser ball acne pore cleanser face wash
$ 1.5 ~ $ 2.5
>=3000 Piece
Meo Food Co., Ltd.
120Ml Deep Cleansing clarifying makeup remover facial cleansing gel face cleanser
$ 20
>=100 Piece
Meo Food Co., Ltd.
Organic 24K Gold Multi-Vitamin Deep Peeling Facial Exfoliator Cleanser Gel For Blackhead Remover
$ 1.58
>=1000 Piece
Meo Food Co., Ltd.
Cleansing Mousse Natural Daily Foaming Face Wash Anti Acne and Collagen Facial Cleanser For Oily Skin
$ 1.8 ~ $ 2.7
>=100 piec
Meo Food Co., Ltd.
Private Label Skin Deeply Cleansing Face Wash Whitening Facial Cleanser for Men
$ 1.3 ~ $ 1.9
>=500 Piece
Meo Food Co., Ltd.
USB charging accept private facial cleansing brush face wash facial cleanser
$ 5.8 ~ $ 8.8
>=100 Piece
Meo Food Co., Ltd.
Private Label Natural Organic Activated Charcoal Deep Cleansing Detox Face Cleanser,Face Wash
$ 1.2 ~ $ 1.6
>=1000 Piece
Meo Food Co., Ltd.
Private Label Oil-Free Acne and Redness Facial Cleanser Soothing Face Wash with Salicylic Acid
$ 1 ~ $ 5
>=1000 Piece
Meo Food Co., Ltd.
Organic paraben free Oil Balancing, Acne Control and Skin Lightening Toner with Tea Tree Oil
$ 2.5 ~ $ 8
>=1 Piece
Meo Food Co., Ltd.
Oily skin facial cleanser for acne
$ 0.5 ~ $ 0.8
>=10000 Piece
Meo Food Co., Ltd.
Most Popular Hyaluronic Acid & Amino Acid Cleanser Bubble Massage Face Foam Cleanser
$ 1.2 ~ $ 1.6
>=96 Piece
Meo Food Co., Ltd.
Gollee Lash Cleaner Shampoo Bottles Foam Cleanser For Eyelash Extensions Shampoo Cleansing Lash Foam Wash Eyelash Cleansing Foam
$ 3 ~ $ 4.1
>=20 Piece
Meo Food Co., Ltd.
Solanie Micellar Cleanser and make-up remover
$ 2.59 ~ $ 3.37
>=50 Piece
Meo Food Co., Ltd.
Coconut Oil Facial Cleansing Foam 100ml
$ 160
>=8 Carton(s)
Meo Food Co., Ltd.
High Quality Natural Foaming Face Cleanser For Sensitive Skin
$ 1.45
>=12000 Piece
Meo Food Co., Ltd.
OEM/ODM Skin Care Amino acid Facial Foam Cleanser Pore Cleansing and Blackhead Remover Face Wash
$ 1.32 ~ $ 1.68
>=3000 Piece
Meo Food Co., Ltd.
Natural Deep Cleaning and Nourishing Bamboo Charcoal Wash Facial Cleanser
$ 0.8 ~ $ 1.8
>=1000 Piece
Meo Food Co., Ltd.
Organza Foaming net facial cleanser PE net for facial cleansing bath soap net A95
$ 0.25 ~ $ 0.27
>=20000 Piece
Meo Food Co., Ltd.
Best skin cleanser clearing soap non drying non oily face wash for sensitive skin
$ 0.9 ~ $ 1.6
>=5000 Piece
Meo Food Co., Ltd.
Private Label Taiwan skincare OEM ODM OBM Free sample Deep soothes and tones Refreshing Moisturizing Creamy Cleansing Milk
$ 2.5 ~ $ 4
>=3000 Piece
Meo Food Co., Ltd.
Private Label Oil Control Bamboo Charcoal Facial Cleanser
$ 1.1 ~ $ 1.9
>=500 Unit
Meo Food Co., Ltd.
Skin Clearing Face Wash/Anti Acne Facial Cleanser with Tea Tree Oil
$ 1.99 ~ $ 4.99
>=500 Piece
Meo Food Co., Ltd.
Private Label face foam natural facial cleanser deep cleaning hydration 2in1 Makeup Remover Mousse
$ 2.31 ~ $ 2.85
>=11 piec
Meo Food Co., Ltd.
Japan Camellia oil facial cleansing oil 150ml Wholesale
$ 2.59 ~ $ 3.17
>=2200 Piece
Meo Food Co., Ltd.
Oxygen mask cleanser, remove dirt and makeup, Korean cosmetic brand
$ 7 ~ $ 8
>=1 Piece
Meo Food Co., Ltd.
2020 Hot Sell Beauty Skin Whitening Cleanser Facial Cleanser amino acid cleanser
$ 0.99 ~ $ 1.59
>=5000 Piece
Meo Food Co., Ltd.
Eyelash Extension Oil Free Cleansing Foam Shampoo
$ 5 ~ $ 15
>=50 Piece
Meo Food Co., Ltd.
Deep clean Whitening & Moisturizing facial cleanser
$ 2.4 ~ $ 3
>=192 Box(es)
Meo Food Co., Ltd.
VIBRANT GLAMOUR Amino acid Facial Cleanser Oil Control Moisturizing Shrink Pores Free Shipping
$ 8.99 ~ $ 9.39
>=3 piec
Meo Food Co., Ltd.
Face Cleansing FREE SULFATE SHAMPOO, HAIGH QUALITY Tea Tree OIL Perfect HERBAL PURE Adults Gel Sgs Female Pore Cleaner Whitening
$ 2.54 ~ $ 2.89
>=1000 Piece
Meo Food Co., Ltd.
OEM Facial Cleanser, Private Label from Thailand
$ 8 ~ $ 10
>=2000 Carton(s)
Meo Food Co., Ltd.
Free Samples Low MOQ Body Back Massage Gel Exfoliator
$ 53.3 ~ $ 53.4
>=1 Piece
Meo Food Co., Ltd.
2020 Best Sell Own Brand Of Plant Extracts Cleansing Oil
$ 7 ~ $ 8
>=6 Piece
Meo Food Co., Ltd.
green tea foaming oil free facial cleansers makeup remover
$ 1.92 ~ $ 2.24
>=2 Piece
Meo Food Co., Ltd.
MELAO Skin Care Organic Make-Up Removing Solution Moisturizing Oil Free Face Lip Eye Makeup Micellar Cleansing Water
$ 2.1 ~ $ 2.7
>=500 Piece
Meo Food Co., Ltd.
Glycolic Acid-Acne Facial Wash For a Deep Clean-Anti Aging AHA Peel for Acne Wrinkle Reduction Face Wash Scrub Facial Cleanser
$ 2.68 ~ $ 3.85
>=1000 Piece
Meo Food Co., Ltd.
Private Label OEM LOGO Oil Free Cleanser Eyelash Shampoo Lash Foaming Cleanser for Eyelash Extension
$ 3.5
>=1 Piece
Meo Food Co., Ltd.
face pore cleansing oil blackhead cleanser balancing and mild for sensitive skin
$ 2.47 ~ $ 2.65
>=1000 piec
Meo Food Co., Ltd.
Related Searches:
ahafacewashbestfacialcleanserforoilyskineskinolpapayamoisturizingfacewashbestexfoliatingfacewashbestcleansingbrushcetaphilfacewashsheamoisturefacewashfacewashfordryacneproneskingentlefacecleansermorningburstbestfacewashforacneneutrogenadeepcleanfacewashgoodfacialcleanserglycolicfacewashbestmen'sfacewash2018cetaphilgentlefacewashbestfacewashforsensitivecombinationskindovefacialcleanserbestcrueltyfreefacewashproactivdeepcleansingwashskinfacewashbestwaterbasedcleansercoconutoilfacewashhoneyfacewashantiacnefacewashpurposefacialcleansereltamdcleanserfacewashforacneproneskinrdlcleanser