Welcome to TradeChina
-
RELATED CATEGORIES:
Bioaqua 30g Acne Treatment Blackhead Remova Anti Acne Cream Oil Control Shrink Pores Acne Scar Remove Face Care Whitening
$ 0.52 ~ $ 0.62
>=12 pieces
Meo Food Co., Ltd.
Skin Care Yoxier Remove Acne Pimples Cream Oil Control Acne Cream Face Acne Cream
$ 1.91 ~ $ 2.31
>=50 pieces
Meo Food Co., Ltd.
DR.RASHEL Natural No Side Effect Anti Acne Oil Control Brightening Whitening Vitamin C Face Cream
$ 2.28 ~ $ 3.28
>=50 pieces
Meo Food Co., Ltd.
Oil Control Face Cream Aloe Vera Whitening Cream Aloe Vera Sun Cream
$ 2.49 ~ $ 3.08
>=50 Piece
Meo Food Co., Ltd.
acne treatment face cream blackhead repair gel oil control shrink pores scar whitening moisturizer skin care korean cosmetics
$ 37.5 ~ $ 42
>=3 kilograms
Meo Food Co., Ltd.
Snail Cream Moisturizing Oil Control Snail Repair Cream Nourishing Snail Collagen Essence Face Cream
$ 1.4 ~ $ 1.72
>=10 pieces
Meo Food Co., Ltd.
Bioaqua Best Face Anti Acne Treatment Oil Control Whitening Moisturizing Pores Deep Scar Remover Cream
$ 0.69 ~ $ 0.88
>=50 pieces
Meo Food Co., Ltd.
1pcs Anti Acne Cream Oil Control Shrink Pores Nourish Skin Acne Scar Remove face cream 15g
$ 1.1 ~ $ 1.3
>=6 pieces
Meo Food Co., Ltd.
Private Label Face wash Deep Cleansing Gentle Natural Organic Edelweiss Refreshing Oil Control Facial Cleanser Cream
$ 1.54 ~ $ 1.93
>=1000 boxe
Meo Food Co., Ltd.
VIBRANT GLAMOUR Tea Tree Oil Control Shrink Pores Acne Nourish Whitening Skin Care Face Cream
$ 1.91 ~ $ 2.2
>=10 pieces
Meo Food Co., Ltd.
MABREM Salvia Acne Treatment Cream Removal Face Blackhead Anti Acne Cream Oil Control Shrink Pores Acne Scar Face Care Whitening
$ 4.23 ~ $ 5.22
>=3 pieces
Meo Food Co., Ltd.
oEM face cream lotion oil -control moisturizing for men
$ 0.8 ~ $ 1.18
>=2 Piece
Meo Food Co., Ltd.
Natural Herbal Acne Removal Facial Whitening Cream Skincare Moisturizing Pimples and Dark Spot Remover Oil Control Ginseng Cream
$ 1.65 ~ $ 2.15
>=3 piec
Meo Food Co., Ltd.
Olive Peptide Firming Anti-Wrinkle Cream Reduce Face Fine Lines Tighten Pores Whitening Oil Control Acne hydrating skin Product
$ 1.6 ~ $ 1.9
>=3 Piece
Meo Food Co., Ltd.
Related Searches:
alcoholfreefacecreampondsdryskincreamacneegyptianmilkfacecreamaveenodaycreamoilbasedmoisturizerfordryskinskinfirmingfacecreambestfacelotionfordrysensitiveskinlightfacecreamfacelotionforacneproneskinantiagingfacemoisturizermoisturisingcreamceravedailymoisturizerfordryskincetaphilmoisturizingcreamfaceandbodythebestmoisturizerforsensitiveskincheapmoisturizerfordryskinpinkfacecreambestfacemoisturizer2019lakmemoisturisercreambestmoisturizerforfacemenphysiogelcalmingrelieffacecreammalefacecreamfacecreamwithsunscreenbestcreamforevenskintonenoncomedogenicfairnesscreamdailyfairnesscreammostmoisturizingfacecreambestdaycreamformencocoabutterlotiononfaceoriginsmoisturizerforoilyskingoodmoisturizingcream