Welcome to TradeChina
-
RELATED CATEGORIES:
Hand and Body Lotions Gift Box Hyaluronic Acid Whitening Moisturizing Hand Care Kit Hand Creams
$ 0.7 ~ $ 0.9
>=2000 piec
Meo Food Co., Ltd.
Wholesale Toner Essence Milk Oil Control Cleanser Refreshing Moisturizer Set
$ 43.24 ~ $ 86.48
>=1 Set
Meo Food Co., Ltd.
New arrive promotion Luxurious women spa moisturizing bath gift set
$ 2.9 ~ $ 4.35
>=1000 Set
Meo Food Co., Ltd.
2020 new design Low Cost High Quality natural Bath and Body Wash set moisturize body care spa bath gift set
$ 2.26 ~ $ 3.89
>=500 Set
Meo Food Co., Ltd.
Custom women men shower gel wooden box bath set body lotion moisturizer luxurious organic bath gift set
$ 2.09
>=2000 piec
Meo Food Co., Ltd.
High quality moisturizing body care bath gift set for spa
$ 1.8 ~ $ 2.57
>=1000 Set
Meo Food Co., Ltd.
Wholesale moisturize private label body care bath spa gift set body lotion bath bomb hotel bath set 2020
$ 2.39 ~ $ 2.65
>=2000 Set
Meo Food Co., Ltd.
Wholesale OEM design Family use moisturizing bubble bath body wash spa gift set for Christmas
$ 9.45 ~ $ 10.19
>=1000 Set
Meo Food Co., Ltd.
Wholesale coconut fruit moisturizing body Care basket bath gift Set for hotel
$ 3 ~ $ 10
>=2000 Piece
Meo Food Co., Ltd.
Spa moisturizing shower gel best selling bath gift set with body scrub
$ 2.45 ~ $ 2.88
>=1000 Set
Meo Food Co., Ltd.
Macaron style soap gift set
$ 6.72
>=100 Piece
Meo Food Co., Ltd.
New Product Pro-Xylane Hair Shampoo Bath Set Moisturizing Shower Bath Gift Set For Spa
$ 3.2 ~ $ 3.6
>=40 Set
Meo Food Co., Ltd.
Luxurious moisturizing whitening body lotion toiletry bath gift set for hotel
$ 3.3 ~ $ 4.2
>=3000 Set
Meo Food Co., Ltd.
Promotional facial cleanse beard care gift set men moisturizing face skin care set
$ 3.7
>=2000 Set
Meo Food Co., Ltd.
Wholesale delicate multicolor label moisturize body care spa products vanilla bath gift set for home
$ 0.5
>=3000 piec
Meo Food Co., Ltd.
Christmas Hardback skin refresh body hand moisturizing lotion gift set
$ 1.5 ~ $ 2
>=2000 Piece
Meo Food Co., Ltd.
Luxury Bath Gel And Body Cream Personal Care Set Moisture Spa Bath Gift
$ 0.1 ~ $ 3
>=5000 Piece
Meo Food Co., Ltd.
China Factory Hot sales OEM Bath Kit Moisturizing Body Care SPA Bath Gift Set
$ 3 ~ $ 5
>=10000 Set
Meo Food Co., Ltd.
Wholesale Special Hot Selling Fragrance Body Mist Moisturizing 120Ml Bath Gift Set
$ 0.33
>=5000 Set
Meo Food Co., Ltd.
Hot Sale Boxset Coconut Amino Acid Body Care Coconut Shower Gel Shampoo Body Lotion Private Label Shower Gel Bath Box Set
$ 2.7 ~ $ 4.18
>=12 piec
Meo Food Co., Ltd.
Popular selling OEM ODM BIOAQUA rorec Beauty Skin Care 5pcs moisturizing Hand Cream Gift Set
$ 0.48 ~ $ 0.61
>=144 Bag(s)
Meo Food Co., Ltd.
Professional Factory Nourishing Moderate Baby Shower Gift Set,No Tears Organic Baby Shampoo
$ 4 ~ $ 4.32
>=240 Piece
Meo Food Co., Ltd.
Promotional wood heart box 6pcs bath accessory set, Sisal sponge /comb Wooden box spa set /Bath Gift Set
$ 1.65 ~ $ 4.68
>=2 Set
Meo Food Co., Ltd.
Wholesale Private Label Natural Organic Vegan Rainbow Bubble Bath Bombs Gift Set
$ 2.8 ~ $ 4.6
>=2 piec
Meo Food Co., Ltd.
Flower Moisturizing Body Wash & Hand Cream Set
$ 4.99 ~ $ 5.99
>=5000 Set
Meo Food Co., Ltd.
Custom Private Label Mini Natural Organic Shea Butter Honey Whitening Moisturizing Lavender Perfume Hand Cream Lotion Gift Sets
$ 0.11 ~ $ 0.32
>=1000 Pair
Meo Food Co., Ltd.
ODM/OEM Vanilla deep cleaning exfoliating SPA bath gift set
$ 1.03 ~ $ 1.95
>=10000 Set
Meo Food Co., Ltd.
Wholesale 10 Pieces Moisturizing Bath and Body Works Spa Gift Set for Women
$ 3 ~ $ 7.99
>=5000 Piece
Meo Food Co., Ltd.
6 Pcs Moisturizing and whitening bubble Bath and Body Gift Set with Perfect Gift Box for Women
$ 9.69 ~ $ 10
>=60 Unit
Meo Food Co., Ltd.
High quality moisturizing bath set body care bath gift for spa
$ 2.35 ~ $ 3.05
>=50 piec
Meo Food Co., Ltd.
OEM Private Label Luxury Travel Body Skin Care Cosmetic Bath Spa Gift Amenities Set
$ 4.5
>=100 Set
Meo Food Co., Ltd.
Wholesale Private Label Moisturizing Hand Cream Hydrating Skin Care Exfoliator Hand Creams
$ 0.38 ~ $ 0.39
>=10000 piec
Meo Food Co., Ltd.
Wholesale Men Daily Use Moisturizing Personal Care Basket Bath And Body Gift Set
$ 0.7 ~ $ 3
>=1000 Piece
Meo Food Co., Ltd.
Wholesale Private Label Bath and Body Works Product OEM Aromatherapy Spa Bathing Gift Set
$ 2 ~ $ 2.5
>=1000 Piece
Meo Food Co., Ltd.
OEM bath set fair and white body lotion body wash shower gel body lotion wholesale
$ 1.5 ~ $ 2
>=1000 Set
Meo Food Co., Ltd.
OEM All Natural Organic Fizzies Shea Butter Cocoa Moisturizing Dry Skin Fizz Bath Bomb Gift Set
$ 1.35 ~ $ 2.3
>=1000 Set
Meo Food Co., Ltd.
Bath Spa Gift Set Spa Luxetique Spa Gift Set Rose Bath Set
$ 3.65 ~ $ 3.85
>=1000 piec
Meo Food Co., Ltd.
BBC bath and body products gift set body scrubs sugar beauty personal care cleaning
$ 1.8 ~ $ 3
>=5000 Set
Meo Food Co., Ltd.
2019 bath and body gift set wholesale in pvc bag
$ 4 ~ $ 6
>=5000 Bag(s)
Meo Food Co., Ltd.
6pcs rose extract shampoo set shower gel shampoo body lotion care series body care bath spa kit gift set
$ 7.66 ~ $ 8.44
>=16 Set
Meo Food Co., Ltd.
Wholesale Bath And Body Gift Set Baskets With Shower Gel, Body Lotion, Bath Fizzer - 462114703
$ 3 ~ $ 9
>=1000 Set
Meo Food Co., Ltd.
Wholesale OEM Shower Gel Gift Set , Herbal Handmade Gift set Thailand
$ 46 ~ $ 48
>=50 piec
Meo Food Co., Ltd.
Private Label Beautiful Pure Natural Essential Oil Moisturizing Bath Sets Bath Gift Sets Spa With Bath Bomb
$ 6.32 ~ $ 7.05
>=5000 Piece
Meo Food Co., Ltd.
Gift Sets- glitter hair gel&shimmering face body oil over mist
$ 1.1 ~ $ 1.45
>=3000 Set
Meo Food Co., Ltd.
Natural Bath Set Foot Moisturizing Body Smooth Whitening Spa Gift Kit OEM
$ 4.23 ~ $ 6.86
>=1000 piec
Meo Food Co., Ltd.
Christmas gift set with skin care and whitening body lotion shower gel
$ 1.5 ~ $ 4.99
>=2000 Set
Meo Food Co., Ltd.
Manufacturers luxury bath spa gift set whitening body lotion perfumed shower
$ 0.49 ~ $ 1
>=1000 Set
Meo Food Co., Ltd.
Wholesale Private Label Aromatherapy Oil firming moisturizing cream rose fragrance Bathing Set
$ 9.8 ~ $ 10.5
>=100 Piece
Meo Food Co., Ltd.
lavender bath gift set
$ 1.2 ~ $ 2.5
>=3000 Set
Meo Food Co., Ltd.
wholesale customized bath spa gift set mug cup and sock bath gift set
$ 1.8 ~ $ 2.4
>=1000 Piece
Meo Food Co., Ltd.
Related Searches:
skincareproductsgiftsetkoreanrejuvenatingsetolayskincaresetetudemoistfullcollagensetolaycreamsetkoreanskinrejuvenatingsetkoreanskincareproductssetevehansenantiagingserumsetatomytravelkitgoldenskincaresetmensfacecreamgiftsetsbxglowskincaremensfacewashsetgreenteabalancingskincaresetskincareproductssetfacialtreatmentsetatomyantiagingsetbestmen'sfacecaresetatomyskincare6setcollagencreamsetbrighteningwithglutasetatomyskincaresetbodyshopskincaresetskincarefullsetmarykaytimewiserepaircleanserskinbrighteningsethadalaboskincaresetbestskincaresetformenthefaceshopskincarestarterkitetudehouseskincareset