Welcome to TradeChina
-
RELATED CATEGORIES:
Food Truck Street Outdoor Vintage Food Vending Truck Glass Sliding Window food Cart with Cooking Equipmen For Sale
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Best Quality Bakery Food Cart Milkshake Vending Cart
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
European standard mobile fried ice cream roll fast crepes kiosk vending cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New Style Mobile bakery hot dog cart milkshake vending hot dog cart churros food kitchen hot dog cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
professional modern mobile commercial mobile grill cart/hot food vending cycle cart and trolley/milkshake vending cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
street fast food vending trailer electric food truck for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CRT165 2019 Hot Selling Mobile Commercial Milkshake Vending Juice Bar Food Kiosk Cart
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Most world popular novel appearance milkshake vending cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Homeedible ink coffee milkshake beer machine printer 3d printer machine art printer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
JX-FR400W Sandwich hamburger vending catering food cart business for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Chocolate milkshake food truck food display vending kiosk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Supply high quality Hard Plastic PP Transparent Cup with Lids Ideal for beverage, Milkshake,cold drinks
$ 0.02
>=5000 piec
Meo household Co.LTD
Low cost street food trailer cart mobile crepe carts milkshake vending cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coconut Chocolate Milkshake Fruit Commercial Food Display Vending Kiosk Cabinet Trailer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
fruits vending cart/milkshake vending cart
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
electric lamb grilled traveling fiberglass food kiosk with milkshaker
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New Style Mobile bakery hot dog cart milkshake vending hot dog cart churros food kitchen hot dog cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China Manufacturer Price Self-Service Vending Ice Cream Gelato Making Machine Coin Operated
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Protein Milkshake Energy Drink Vending Machine with LCD screen
$ -
>=1 Set
Meo Advertising Co.LTD
Cheap price 304 Stainless Steel Double cup commercial milkshake machine
$ 20 ~ $ 65
>=5 Piece
Meo Textile Clothing Co.LTD
Milk Shake Vending Machine Milk Shake Mixer Machine Automatic Milk Shake Making Machine
$ 190 ~ $ 260
>=1 Piece
Meo Textile Clothing Co.LTD
2021 Wholesale Industrial soft serve ice cream frozen yogurt machine
$ 100
>=1 Unit
Meo Textile Clothing Co.LTD
double head milk shake machine milk shake making machine machine milk shake
$ 58 ~ $ 60
>=1 piec
Meo Textile Clothing Co.LTD
Mini Commercial Milkshake Vending Food Catering Service Cart Mobile Cars for Fast Food
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Mobile Advertising Trailer Milkshake Vending Cart Military Metal Catering Vehicle for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Custom American fashion food truck, street mobile vending kiosk cart for coffee cold drinks, pizza crepe waffle van trailer
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Good Quality 110KM/H Gasoline Fast Milkshake Vending Cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Selling Mobile Shawarma Grill Food Truck/Milkshake Vending Truck
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Bakery food trailer milkshake vending cart juice cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
milkshake vending kiosk mobile crepe food cart trailer for hot dog
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Street Attractive Boat Shape Coffee Vending Food Trailer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
shanghai zhicheng removable snack vending fried ice cream cart
$ 999
>=1 Unit
Meo Textile Clothing Co.LTD
best quality milkshake vending kiosk bakery food kiosk juice food kiosk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Popular Stainless Commercial Truck Pizza Food Trailer Popcorn Mobile Vending Food Cart for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Milkshake vending cart popcorn vending cart Drink Vending Cart
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Wholesale Industrial 3 flavor soft serve soft ice cream machine
$ 100
>=1 Unit
Meo Textile Clothing Co.LTD
Chinese Bright Blue Smoothie chocolate milkshake coffee food truck
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Petrol Used Hot Dog Cart Milkshake Vending Trailer Sweet Corn Truck Food Wagon Cart for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Australian Standard Enclosed Container Food Truck/Milkshake Food Trailer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Sushi, Milkshake, Waffle Crepes Mobile Kebab Australia Standard Food Truck BBQ Mobile Food Trailer for beer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
chips vending food cart chocolate milkshake truck churros food kitchen kiosk
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Good Selling Mobile Food Trailer Milkshake Truck
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Industrial yogurt making machine heavy duty soft ice cream machine
$ 100
>=1 Unit
Meo Textile Clothing Co.LTD
Churros food display kiosk coffee and beverage trailer fast food vending van
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Milkshake Vending Cart Military Mobile Kitchen Trailer Metal Catering Vehicle for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Customized Made 3000mm Long Food Kitchen Truck/ Milkshake Vending Truck
$ -
>=1 Set
Meo Textile Clothing Co.LTD
food trucks mobile food trailer bike food cart trailer Sushi, Milkshake, Waffle cocktail beer truck
$ -
>=1 Set
Meo Textile Clothing Co.LTD
coffee food trailer, fast food kiosk/street vending carts/ multi-purpose mobile fast kiosk cart to sell churros
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2021 Wholesale 3 flavor automatic self serving soft yogurt machine equipment
$ 100
>=1 Unit
Meo Textile Clothing Co.LTD
Commercial juice vending cart for business
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
vendopepsimachineantiquecocacolamachineicevendingmachinebusinessforsalemeivendingmachinenayaxcardreaderpeanutvendingmachinecafecoffeedayvendingmachinepricevendingmachinesforsaleebayteaandcoffeemachineforofficeautomaticcoffeevendingmachineusedsodavendingmachinesforsalenearmesodavendingmachinebusinessnestlecoffeevendingmachineskittlesvendingmachineforsalebubblegumvendingmachineantaresvendingmachinefrozenfoodvendingmachinesvendingsupplytopvendingmachinecompaniesretrocokemachineusedcokemachinetoycapsulemachinelocalvendingmachinecompaniesusedcombovendingmachinescandymachinetoylavazzavendingcashlessvendingmachinesvendingmachineshopminipopmachineicevendingmachinebusiness