Welcome to TradeChina
-
Granulated herbal heath tea
$ 8 ~ $ 10
>=496 Kilogram
Meo Auto Parts Co.LTD
Sweet And Fragrant Light Yellow Baked Chrysanthemum Dried Cozy Herbal Tea Chinese
$ 99 ~ $ 150
>=12 Bag(s)
Meo Auto Parts Co.LTD
Japan business man Herbal mellow flavor mint green tea bag
$ 16 ~ $ 23
>=1 Carton(s)
Meo Auto Parts Co.LTD
Japan best-selling rich nutritional value herbal tea bag bulk
$ 3.7 ~ $ 4.7
>=60 Pack
Meo Auto Parts Co.LTD
JUST T "Unforgettable Moroccan Mint" Organic Herbal Infusion Peppermint Tea
$ 5.07 ~ $ 7.8
>=1 Pallet
Meo Auto Parts Co.LTD
Best-selling mellow disposable shaped tea bags herbal product
$ 3.7 ~ $ 4.7
>=60 Pack
Meo Auto Parts Co.LTD
Brand new Mango Fresh Mint indonesia herbal tea slimming high quality loose fresh authentic flavoured teas
$ 68.11 ~ $ 204
>=1 Kilogram
Meo Auto Parts Co.LTD
Moringa Mango Herbal Tea in Biodegradable Pyramid Tea Bags Individual in Boxes - Tarlton Travel Pack //Tea Bag Kit
$ 0.08 ~ $ 0.1
>=5000 piec
Meo Auto Parts Co.LTD
T231 High quality chinese herbal flower Mango passion fruit tea for health
$ 56.7
>=1 Kilogram
Meo Auto Parts Co.LTD
Chinese Breeze Spring Organic Cherry Rose Blossom herbal Tea Premium Chamomile Fruit Essence Flavored Blend Ginger Black Tea
$ 18 ~ $ 88
>=10 Kilogram
Meo Auto Parts Co.LTD
Organic fresh slices drink tea be in great demand dried fruit mango food fruits for human skin and beauty
$ 0.35 ~ $ 0.45
>=100 piec
Meo Auto Parts Co.LTD
USA Standard Health Beauty Drink Flower Blend Herbal Fruit Tea
$ 2.7
>=10000 boxe
Meo Auto Parts Co.LTD
Wholesale Fruit Tea Product Type Certified Organic Mango Cranberry Fruit Flavor Tea
$ 9.2 ~ $ 22
>=5 Kilogram
Meo Auto Parts Co.LTD
Fruit feast tea free sample loose fruit tea private label OEM packing triangle pyramid tea bags
$ 28 ~ $ 29
>=5 Kilogram
Meo Auto Parts Co.LTD
lemon ginger herbal tea
$ 1.28 ~ $ 2.08
>=2000 Box(es)
Meo Auto Parts Co.LTD
Organic Earl Grey Black Tea Whole Fruit Bergamot Mango Cranberry Creme Decaf Hot Cinnamon Spice Flavored Tea
$ 18 ~ $ 88
>=10 Kilogram
Meo Auto Parts Co.LTD
Weight loss Mango Enzyme tea powder, slimming Chinese herbal tea
$ 6.5 ~ $ 8.8
>=10 Box(es)
Meo Auto Parts Co.LTD
Lifeworth passion fruit basil seed juice drink green tea for loss weight
$ 4.2 ~ $ 5.2
>=500 Bag(s)
Meo Auto Parts Co.LTD
new arrival customized blended detox night slimming tea with mango flavor free samples available best flavor weight losss drink
$ 2 ~ $ 2.8
>=100 Bag(s)
Meo Auto Parts Co.LTD
Professional Mango Tango Fruits chinese bags herbal tea organic with CE certificate flower tea
$ 79.1 ~ $ 237
>=1 Kilogram
Meo Auto Parts Co.LTD
Private label flat tummy tea 28 days detox slimming
$ 1.5 ~ $ 3.5
>=20 Piece
Meo Auto Parts Co.LTD
OEM Custom Bulk Premium Organic English Breakfast Earl Grey Black Loose Herbal Tea Blended Flavored Lose Leaf Blend Tea Blends
$ 23 ~ $ 101
>=10 Kilogram
Meo Auto Parts Co.LTD
Private Label Instant Mango Tea Extract Mango Cranberry Fruit Flavor Tea
$ 9.2 ~ $ 22
>=5 Kilogram
Meo Auto Parts Co.LTD
2018 new design Vacuum-packed tea sachets, custom instant diet slim tea in slimming tea
$ 2.5 ~ $ 2.8
>=1 Pack
Meo Auto Parts Co.LTD
Private Label Organic Health Flavor Loose Blend Tea Brand Canned Lemon Mango Peach Osmanthus Oolong Bl
$ 1 ~ $ 2.5
>=50 Bag(s)
Meo Auto Parts Co.LTD
Biodegradable Pyramid Tea Bags High Quality Tea Blend Mango E Menta.private Label Health Tea FLAVORED Tea Fruit Tea Bagged Tea
$ 0.12 ~ $ 0.18
>=100 Box(es)
Meo Auto Parts Co.LTD
Tropicana Delight Black Tea with herbs in Biodegradable Pyramid Tea Bags Individual in Boxes - Tarlton Travel Pack //Tea Bag Kit
$ 0.08 ~ $ 0.1
>=5000 piec
Meo Auto Parts Co.LTD
Weight loss African Mango Enzyme tea powder, slimming Chinese herbal tea
$ 6.5 ~ $ 8.8
>=10 boxe
Meo Auto Parts Co.LTD
Bulk Organic English Breakfast Lemon Black Herbal Blended Flavored Lose Leaf Tea Blends
$ 23 ~ $ 101
>=10 Kilogram
Meo Auto Parts Co.LTD
100% natural sources, organic components, lowing blood glucose, healthy supplement , made in Taiwan, Mango Royal Herbal Tea
$ 13.8 ~ $ 23
>=500 Box(es)
Meo Auto Parts Co.LTD
RtopR Mango Remove pregnancy scars cream Stretch marks treatment skin care cream
$ 1.25 ~ $ 1.55
>=3 piec
Meo Food Co., Ltd.
New Type Customized Whitening Brightening Exfoliating Fruit Mango Papaya Face And Body Scrubs
$ 1.2 ~ $ 1.6
>=100 piec
Meo Food Co., Ltd.
OEM Wholesale Skin Whitening Clean Vegan Natural Organic Fruit Mango Papaya Foaming Face Body Scrub Cream
$ 0.6 ~ $ 1.6
>=100 piec
Meo Food Co., Ltd.
Private Label Exfolianting Face Bodyscrub Strawberry Avocado Mango Coconut Milk Papaya 100% Natural Fruit Scrub
$ 1.35 ~ $ 1.95
>=500 Piece
Meo Food Co., Ltd.
Dark plum black tea iced drink, mango ice tea drink
$ 0.24 ~ $ 1
>=1560 Piece
Meo Auto Parts Co.LTD
Organic Exfoliating Brightening high quality whitening plastic mango Brown Sugar Scrub
$ 2.2 ~ $ 3.9
>=10 Piece
Meo Food Co., Ltd.
OEM/ODM Unrefined Mango butter Raw Mango Seed Butter Cream
$ 20.12 ~ $ 40.48
>=1 Kilogram
Meo Food Co., Ltd.
Custom Package Kraft Paper Fruit Dried Tree Herbal Tea Waterproof Packaging Plastic Chips Chewy Soft Candy Mango Bags
$ 0.02 ~ $ 0.06
>=5000 piec
Meo household Co.LTD
Amazon Hot Sell Wholesale Private Label 24 Hour Intense Moisturizer Softening Body Scrub With Mango Seed Oil For Women And Men
$ 1.34 ~ $ 2.28
>=1000 Box(es)
Meo Food Co., Ltd.
Menior Mango Whitening body lotion Skin Smoother Remove Gallinaceous skin Body Lotion OEM custom brand
$ 3.5 ~ $ 4.5
>=500 piec
Meo Food Co., Ltd.
ICEA TEA 330 ML CAN
$ 1
>=1500 Carton(s)
Meo Auto Parts Co.LTD
black tea bulk Mango flavored tea pineapple rose petals cornflower herbal slimmed waist loose fruit natural flower tea leaves
$ 4.47 ~ $ 14.67
>=1 Unit
Meo Auto Parts Co.LTD
Clean face mask beauty skin green tea clay mask oem exfoilating face mask for smooth skin
$ 0.95 ~ $ 1.2
>=1200 Piece
Meo Food Co., Ltd.
Wholesale Private Label Organic Lemon Mango Fruit Coconut Hyaluronic Acid Moisturizing Soothing Silk Mask Facial Mask Sheet
$ 0.05 ~ $ 0.25
>=10 piec
Meo Food Co., Ltd.
Terpenes Isolates Linolool Lemonde Blue dream Pink Kush Sour Herbal Fuel Diesel Terpenes and Terpens infused Herbal Blends
$ 16.5 ~ $ 35
>=10 Kilogram
Meo Auto Parts Co.LTD
Amazon Hot Sell Custom Logo Mango Face Exfoliator African Himalayan Sea Salt Body Whiting Scrub With Fragrance
$ 0.3 ~ $ 0.78
>=100 Piece
Meo Food Co., Ltd.
India Sandalwood Herbal Handmade Soap Skin Care Toilet Soap
$ 0.5 ~ $ 0.68
>=10 piec
Meo Food Co., Ltd.
Skin Body Cleaning Herbal Bath Natural Handmade Whitening Face Soap With Petal
$ 1 ~ $ 1.6
>=10 piec
Meo Food Co., Ltd.
Dark plum black tea iced drink, mango tea drink
$ 0.24 ~ $ 1
>=1560 Piece
Meo Auto Parts Co.LTD
Organic French White Peach Tea Passion Fruit Mango Orange Best Tasting Vanilla Flavor Pure Leaf Oolong Tea
$ 18 ~ $ 88
>=10 Kilogram
Meo Auto Parts Co.LTD
Related Searches:
earlgrayflavorbigelowgingerpeachteadarjeelingteaflavorlooseleafpeachteanesteamilkteapeachteapacketsmatchagreenteaflavorassamteaflavorpearlmilkteaflavorgreenteaandpeachchaiteaflavornestearaspberryteaberrygreenteaallarizonaicedteaflavorsmostpopularmilkteaflavorspureleaftearaspberryoreogreenteamilkteaflavorspureleafnewflavorswhitepeachoolongbigelowherbalteaflavorsbubbleteatypesuniqueflavorsteapureleafraspberryicedtearaspberrypeachtealycheeiceteachamomileflavorbriskmangofiestatoastedalmondteaearlgreywhitetea