Welcome to TradeChina
-
RELATED CATEGORIES:
custom made plastic cosmetic white bottle bot 250ml 500ml boston white cosmetic pet bottle
$ 0.1 ~ $ 0.25
>=10000 Piece
Meo household Co.LTD
Ball Bottle PE Plastic Bottle 50ml Deodorant Bottle
$ 0.1 ~ $ 0.5
>=1 Piece
Meo household Co.LTD
Made In China Excellent Materia kids plastic water bottle water cup with lid acrylic water cup portable
$ 1.17 ~ $ 1.47
>=2000 piec
Meo Food Co., Ltd.
manufacturer's price plastic effervescent bottle tube bottles for effervescent tablets with spiral caps
$ 0.12
>=5000 Piece
Meo household Co.LTD
Made In China Superior Quality Caps Shampoo Plastic Squeeze Bottle
$ 0.02 ~ $ 0.03
>=10000 piec
Meo household Co.LTD
270Ml Square Packaging Plastic PET Airless Bottle Cosmetics With Pump Cap
$ 0.13
>=5000 Piece
Meo household Co.LTD
Made in China superior quality double wall insulated popular gym water bottle customised
$ 6
>=1 Piece
Meo Food Co., Ltd.
Custom made pump dispenser 250ml 500ml plastic body lotion bottle
$ 0.2 ~ $ 0.35
>=10000 Piece
Meo household Co.LTD
White color transparent Matt Cosmetic Packaging Empty Plastic Mist Spray Bottle Capacity Custom Made Spray Bottle
$ 0.63 ~ $ 0.66
>=1 Piece
Meo household Co.LTD
Biodegradable OEM/ODM 500ml 750ml custom made boston round personal care cosmetic PET bottle, plastic fine mist spray bottle
$ 0.15 ~ $ 0.28
>=5000 Piece
Meo household Co.LTD
Glossy color round plastic bottle custom made PET bottle
$ 0.26 ~ $ 0.3
>=10000 Piece
Meo household Co.LTD
Custom made Plastic Dropper Bottle Flat eye drop bottle 10ml 5ml 15ml
$ 0.03 ~ $ 0.05
>=3000 Piece
Meo household Co.LTD
1L Straight Boston Round Plastic Shampoo Bottle Made In China
$ 0.35
>=10000 piec
Meo household Co.LTD
2015 Shenzhen 600ml protein shaker brands plastic sport water bottle made in China
$ 1.23 ~ $ 1.43
>=1 piec
Meo Food Co., Ltd.
5g 10g 15g 30g 50g custom made plastic bottle design for gel polish plastic nail art designs uv gel bottle
$ 0.1 ~ $ 0.13
>=10000 Piece
Meo household Co.LTD
500ml plastic foam soap bottle made from suzhou haotuo factory
$ 0.42 ~ $ 0.43
>=10000 piec
Meo household Co.LTD
Factory made custom plastic lotion bottle with pump in hot sale
$ 0.35 ~ $ 0.55
>=100 Piece
Meo household Co.LTD
Wholesale pet custom made plastic clear bottle 60ml screw cap for paint honey
$ 0.07 ~ $ 0.12
>=1000 Piece
Meo household Co.LTD
Rose Gold Lid Frozen Beauty Custom Made Tritan Plastic Water Bottle BPA free Clear
$ 2.5 ~ $ 3
>=1000 piec
Meo Food Co., Ltd.
Custom Made Cheap Double Wall Water Bottle Biodegradable Plastic Tumbler
$ 0.46 ~ $ 1.59
>=1 Piece
Meo Food Co., Ltd.
black plastic cream bottle with bamboo lid wooden cap custom made luxury cosmetic 10g 20g 30g 50g 100g 150g 200g 250g pp plastic
$ 0.3 ~ $ 0.45
>=1000 Piece
Meo household Co.LTD
China factory cheap custom made detergent plastic bottle
$ 0.3 ~ $ 0.8
>=10000 Piece
Meo household Co.LTD
Made in China white acrylic plastic bottles square shape and jars with black lid sets
$ 1.35 ~ $ 1.55
>=5000 piec
Meo household Co.LTD
Eco Friendly 100% Biodegradable 32 oz Plastic Drinking PLA Empty Bottles Made of Polylactic acid
$ 0.2 ~ $ 0.8
>=30000 Piece
Meo household Co.LTD
Made In China For Packaging Skin Care Products Useful Plastic wholesale Jar and bottle
$ 0.79 ~ $ 0.85
>=5000 piec
Meo household Co.LTD
large capacity 4 litre plastic bottle with plastic liquid detergent bottle for custom made dergent bottle 4L
$ 0.8 ~ $ 1.2
>=3 piec
Meo household Co.LTD
plastic bottle manufacturing plant made PET 1litre Square food grade new reflowable oil plastic jars
$ 0.33 ~ $ 0.4
>=1980 piec
Meo household Co.LTD
popular custom made Wholesale black Body Wash Bottle HDPE Plastic 500ml Bottle
$ 0.1 ~ $ 0.6
>=1 Piece
Meo household Co.LTD
food grade medicine 50ml plastic PET bottles with cap, pill capsule bottles wholesale made in China supplier
$ 0.16
>=5000 Unit
Meo household Co.LTD
500ml school water tracker bottle made from recycled plastic
$ 0.48 ~ $ 0.5
>=1000 piec
Meo Food Co., Ltd.
Professional Made PET easy open hexagon plastic bottle
$ 0.1 ~ $ 0.4
>=500 Piece
Meo household Co.LTD
Custom made PET material 100ml black plastic bottle with silver ring cap
$ 0.1 ~ $ 0.5
>=10000 Piece
Meo household Co.LTD
made in China good quality bpa free plastic water bottle manufacturing cheap space cup
$ 0.85 ~ $ 1.85
>=1 Piece
Meo Food Co., Ltd.
RTCO Professional disposable custom made plastic bottle
$ 0.2 ~ $ 1.2
>=10000 Piece
Meo household Co.LTD
30ml pet plastic Toner bottle made in China
$ 0.25 ~ $ 0.45
>=10000 Piece
Meo household Co.LTD
Manufacture HUAYI made 5ml fine mist mini plastic pen bottle with cap
$ 0.08 ~ $ 0.11
>=10000 Piece
Meo household Co.LTD
Custom Made 300ml Clear Plastic Bottle Juice
$ 0.22 ~ $ 0.28
>=297 Piece
Meo household Co.LTD
Fitness water bottles 500ML plastic sports bottle with strap made of durable plastic EU certificated eco friendly
$ 0.85 ~ $ 1
>=3000 piec
Meo Food Co., Ltd.
2019 new products custom made aluminum cap hotel shampoo hair liquid soap plastic bottle
$ 0.06 ~ $ 0.16
>=5000 Piece
Meo household Co.LTD
Small MOQ White Shampoo Shower Gel Cylinder Custom Made Plastic Bottle
$ 0.52 ~ $ 0.7
>=1000 piec
Meo household Co.LTD
30Ml White Plastic Cosmetic Packaging Lotion Pump Airless Bottle Made In China Transparent Clear Plastic Bottle 100Ml
$ 0.7 ~ $ 1.2
>=10000 Piece
Meo household Co.LTD
Factory made Transparent 75ml PP Plastic Airless Pump Bottle For Serum Cosmetic
$ 0.41 ~ $ 0.46
>=10000 piec
Meo household Co.LTD
Semi clear frosting custom made 5ml 10ml 15ml plastic pp travel airless lotion bottle
$ 0.18 ~ $ 0.24
>=5000 piec
Meo household Co.LTD
Leave Messages custom made plastic bottles 100ml 150ml 200ml flat white cosmetic pet bottle essential oil bottle for sale
$ 0.23 ~ $ 0.35
>=5000 Piece
Meo household Co.LTD
Customized Joyshaker Plastic Protein Shaker Bottle with Storage ,Shaker Cup with mixer ball made in Shenzhen factory
$ 2.39 ~ $ 2.49
>=100 piec
Meo Food Co., Ltd.
80ml Custom made cylinder plastic PET thick perfume spray bottle
$ 0.85 ~ $ 2
>=2 piec
Meo household Co.LTD
Hot selling Made in china serum capsule plastic medicine bottle
$ 0.1 ~ $ 1
>=3000 Piece
Meo household Co.LTD
Custom Made BPA Free Drink Plastic Tritan Water Bottle By Drawings
$ 1 ~ $ 10
>=5000 Piece
Meo Food Co., Ltd.
custom made empty cosmetic lotion pump plastic bottle
$ 0.69 ~ $ 0.73
>=5000 piec
Meo household Co.LTD
custom made garden use empty refillable black plastic cosmetic trigger spray bottles
$ 0.28 ~ $ 0.3
>=10000 piec
Meo household Co.LTD
Related Searches:
recycledplasticcontainershdpelumberabsplasticrecyclinghdpe2recyclingrecycledplasticmanufacturerswasteplasticsplasticfilmrecyclingpetflakespriceplasticbagrecyclingnearmeplasticrecyclingcompaniesnearmeplasticwastedisposalplasticrecyclingpricesscrapplasticpricesperpoundhdperecyclingupvcrecyclingrecycle2meltingplasticbottlesrecycleplantpotsrecycledplastic4x8sheetsrecyclemedicinebottlespetbottleflakesbagsmadefromrecycledplasticplasticrecyclingbusinessppplasticrecyclingplasticregrindpetbottlecrushingbusinessrecycleplasticathomerecycleplastichangerstypesofplasticwasteplasticcan