Welcome to TradeChina
-
Private label healthy food protein bar with flour free and gluten free
$ 3 ~ $ 100
>=1 Piece
Meo Auto Parts Co.LTD
Gluten Free Keto Protein Bars Natural Ketogenic Toasted Coconut Vegan Low Carb Low Sugar
$ 2.98 ~ $ 4.25
>=300 Bag(s)
Meo Auto Parts Co.LTD
Crunchy Delicious Baked Crackers Multi Grain Sea Salt Mini Rectangle Snacks 15 Lb. Gluten-Free. Small size.
$ 3.85
>=5010 Pound
Meo Auto Parts Co.LTD
Gluten Free Keto Protein Bars Natural Ketogenic Chocolate Peanut Butter
$ 2.98 ~ $ 4.25
>=300 Bag(s)
Meo Auto Parts Co.LTD
7-Ancient Grains Sea Salt 3.75 Lb. 10 oz X 6 Units/Case Gluten-Free Baked Snack Crackers. Delicious Food!
$ 3.98
>=5002 Pound
Meo Auto Parts Co.LTD
Vertical Protein Bars Packaging Stick Noodles Food Grain Candy Sachet Pouch Packet Packing Machine For Sugar 5 Kg
$ -
>=1 Set
Meo Textile Clothing Co.LTD
protein bars packaging machine packaging machine spices tea grain machine for manufacturing and printing packaging bag
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Chocolate Flavor Sugar Free Protein Bars with Quinoa Energy Bar Snack
$ 0.92
>=8640 Piece
Meo Auto Parts Co.LTD
2020 New Arrival Free Sample Weight Loss Slimming Meal Replacement Energy Bars Protein Bar
$ 13.49 ~ $ 14.21
>=30 Bag(s)
Meo Auto Parts Co.LTD
HTL-608 Industry Automatic Snack Bar Energy Bar/Protein Bar Making And Cutting Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Sesame Bar Maker Nut Peanut Bars Production Line Protein Cereal Brittle Bar Making forming Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Food supplier popular grain products making machine fig bars twist cookies maker
$ -
>=1 Set
Meo Textile Clothing Co.LTD
salmon tuna cat wet pet canned food tin tins food cat treats pet products grain free protein rich kitten
$ 0.4 ~ $ 0.5
>=20000 Piece
Meo Food Co., Ltd.
Soft Mandorlato Bar Gr. 150 Healthy Snacks To Snack On 150G Protein Snack Gift Box
$ 2.63 ~ $ 2.98
>=1296 Piece
Meo Auto Parts Co.LTD
Automatic protein bar wrapper packaging/sugar bar packaging machine in business
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Automatic Protein Bar Wrapper Packaging/Sugar Bar Packaging Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China Best healthy food Oat oatmeal cereal chocolate protein bar snack forming making machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
High quality Bag Protein Chocolate Bar Pill Packing Machine maquina de helados
$ -
>=1 Carton(s)
Meo Textile Clothing Co.LTD
OEM organic pet food freeze dry food high protein grain free cat food and treats
$ 2.5 ~ $ 3
>=3000 Kilogram
Meo Food Co., Ltd.
Manufacturers Private Label CBD Nutrition Quest Protein Bar Vegan Gluten Free Keto Protein Bar
$ 13.49 ~ $ 14.21
>=30 Bag(s)
Meo Auto Parts Co.LTD
dog wet pet canned tin food salmon tuna pet treats pet products grain free protein rich
$ 0.4 ~ $ 0.5
>=20000 Piece
Meo Food Co., Ltd.
Factory Price Sesame seed Candy Cereal Protein Granola Nut Bar Maker Processing Equipment Peanut Brittle Making Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Highly Nutritional Protein Grain Free Fresh Meat Cat Food Natural Cat Food Treats
$ 5.91 ~ $ 6.68
>=12 Piece
Meo Food Co., Ltd.
Mandorlato Classico Bites - Box Gr. 280 Protein Bar All-In Good Healthy Snack Smart Snack
$ 6.44 ~ $ 7.28
>=480 Piece
Meo Auto Parts Co.LTD
Factory Price Bag Protein Chocolate Bar Pill Packing Machine in sale
$ -
>=1 Carton(s)
Meo Textile Clothing Co.LTD
OEM pet food dry food high protein grain free cat dog food and treats
$ 2.5 ~ $ 3
>=3000 Kilogram
Meo Food Co., Ltd.
Premium Quality Energy Meal Bar High Fiber High Protein 6,000 mg No Sugar Added & Cholesterol Free Product of Thailand
$ 8.49 ~ $ 8.61
>=2250 boxe
Meo Auto Parts Co.LTD
Multi-function Granol bar Protein Bar making machine Fruit nuts cereal candy bar snack food cutting machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Protein energy bar extruder Peanut candy bar making machine and cutting machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
high protein health chicken duck beef cat wet pet canned food tin tins food cat treats pet products grain free
$ 0.4 ~ $ 0.5
>=20000 Piece
Meo Food Co., Ltd.
Pure Natural Organic Healthy Dog Food High Protein Grain Free Bulk Dry Dog Food Super Premium Beef Flavor Vitality Dog Food
$ 3 ~ $ 3.2
>=10 piec
Meo Food Co., Ltd.
Red Fruits (Wild Blueberry or Mortino Castillian Berry & Strawberry) Flavor Sugar Free Protein Bars with Quinoa Energy Bar Snack
$ 0.92
>=8640 Piece
Meo Auto Parts Co.LTD
dog wet pet canned tin food high protein treats pet products grain free gluten free
$ 0.4 ~ $ 0.5
>=20000 Piece
Meo Food Co., Ltd.
High-speed production Bag Protein Chocolate Bar Pill Packing Machine with great price
$ -
>=1 Carton(s)
Meo Textile Clothing Co.LTD
healthy chicken duck beef cat wet pet canned food protein rich high digestibility pet products grain free
$ 0.4 ~ $ 0.5
>=20000 Piece
Meo Food Co., Ltd.
Professional Bag Protein Chocolate Bar Pill Packing Machine with CE certificate
$ -
>=1 Carton(s)
Meo Textile Clothing Co.LTD
Related Searches:
wholegraingranolabarwholewheatgoldfishcrackerswheattostitoswholemealsnacksyogurtnutrigrainbarswholegrainsnackslistcorncrackershealthywheatthinsflavoursbetterchipspinachandkaleoatmealricecakespringleswheatwholegrainsnackstobuywholegrainsnacksforschoolswholegrainproteinbarshomemadenutrigrainbarnutrigrainproteinbarwholegrainenergybarswholegrainsnacksforkidsoatandwholemealbiscuitsoatsnhoneybarsriceandcornpuffsnabiscowholegraincrackerswholegrainpringleswholegraintostitoswholecrackersquakerricecakesglutenfreewholegraincrackersfortoddlerswholewheatgranolabarstostitoswholegraintortillachipswholegrainnachochips