Welcome to TradeChina
-
Facial Cleanser Cleansing Cream Face Wash
$ 9 ~ $ 12.4
>=50 Box(es)
Meo Food Co., Ltd.
Private Label Natural Aloe vera Face Pore cleansing Oil Control Face Wash innovative Facial Cleanser
$ 1.1 ~ $ 1.25
>=5000 boxe
Meo Food Co., Ltd.
CBD Hemp Essential Oil Gentle Best Face Wash Organic Amino Acid Organic Face Wash Paraben Free Fair And Lovely Green Face Wash
$ 1.48 ~ $ 2.22
>=200 Piece
Meo Food Co., Ltd.
Free sample private label facial acne cleanser deep cleansing face wash for oily skin
$ 0.57
>=10000 Piece
Meo Food Co., Ltd.
Wholesale Price Professional Skincare Sulfate Free & Deep Cleansing And Activated Charcoal Men Face Wash
$ 0.77 ~ $ 1.57
>=2 Piece
Meo Food Co., Ltd.
Private Label Facial Cleanser Deep Cleansing Gentle Coconut Face Wash
$ 2 ~ $ 2.8
>=1000 Piece
Meo Food Co., Ltd.
Anti Acne Soothing Natural Moisturizing Oil Free Face Wash With Amino Acid Antioxidant Protection Facial Pore Cleanser Facial
$ 5.54 ~ $ 9.69
>=2 boxe
Meo Food Co., Ltd.
OEM Organic Gentle Makeup Remove Facial Cleanser Mousse Foam Aloe Vera Face Wash
$ 1.6 ~ $ 2.35
>=2 Piece
Meo Food Co., Ltd.
Private Label Organic Bamboo Charcoal Mens Face Wash Deep Cleansing Oil Control Facial Cleanser For Ance Skin
$ 1.75 ~ $ 2.3
>=50 Piece
Meo Food Co., Ltd.
Oem Aloe Vera Extract Vitamin C Face Cleanser Brightening Wrinkle Reducing Face Wash
$ 1 ~ $ 1.45
>=1000 Piece
Meo Food Co., Ltd.
Best Face Wash Whitening Moisturizing Cream Milk Facial Foam Cleanser Face Wash For Man
$ 0.66 ~ $ 1.23
>=48 Piece
Meo Food Co., Ltd.
wholesale premium cleanser moisturizing low acid no drying amino acid whitening face wash for dry sensitive skin
$ 1.3
>=500 Piece
Meo Food Co., Ltd.
Private Label Best Beauty Whitening Smoothing Vitamin C Face Wash
$ 1 ~ $ 5
>=1000 Piece
Meo Food Co., Ltd.
OEM/ODM Bamboo Charcoal facial cleanser Blackhead remover Whitening face wash
$ 1 ~ $ 1.5
>=5000 Piece
Meo Food Co., Ltd.
Private Label Natural Organic Activated Charcoal Deep Cleansing Detox Face Cleanser,Face Wash
$ 1.2 ~ $ 1.6
>=1000 Piece
Meo Food Co., Ltd.
Customized Private Label Wholesale OEM ODM Blacksea Natural Organic Charocoal Face Cleanser Face Wash For Man
$ 0.43 ~ $ 0.59
>=1000 Piece
Meo Food Co., Ltd.
Hot Sale Deeply Cleaning Moisturizing Foaming Face Wash For Men
$ 0.93 ~ $ 1.18
>=10000 Piece
Meo Food Co., Ltd.
Private Label Gentle Organic Aloe Vera Juice Anti-Aging Nourishing Revitalizing Face Wash with Carnosine
$ 3 ~ $ 9.43
>=1 Piece
Meo Food Co., Ltd.
Private label OEM Factory Clean and Clear Whitening Tea tree Foam Face wash for oily skin
$ 0.59 ~ $ 1.49
>=3000 Piece
Meo Food Co., Ltd.
Purifying Oily Skin Deep Whitening Pores Face Wash for Men Volcanic Mud Facial Cleanser
$ 2.45 ~ $ 2.6
>=5000 Set
Meo Food Co., Ltd.
Private label Wholesale Amino acid bubble Face Wash Best Recommended Facial Cleanser for Men Customized facial skincare
$ 3.32 ~ $ 4.08
>=1 Piece
Meo Food Co., Ltd.
Private Label best men face wash Remove Dead Skin Whitening mens facial cleanser
$ 3 ~ $ 3.5
>=3 Piece
Meo Food Co., Ltd.
Oil Control Best Facial Wash For Men Skin Care
$ 2 ~ $ 2.35
>=10 Piece
Meo Food Co., Ltd.
Professional best washes for dry skin private labeling low price male face wash with high quality
$ 0.99 ~ $ 1.08
>=100 Piece
Meo Food Co., Ltd.
Top Personal Care Manufacturer Mens Skincare Set Facial Cleanser Face Wash Men
$ 2.78 ~ $ 3.29
>=1 piec
Meo Food Co., Ltd.
Envisha wholesale Men's Skin Care Organic Face Wash Set Anti Aging Facial Toner Face Wash and Moisturizer Set
$ 2.8 ~ $ 3.2
>=2 Set
Meo Food Co., Ltd.
UO WHIP WASH BLUE 130g
$ 28
>=1 boxe
Meo Food Co., Ltd.
OEM/ODM Deep Cleansing Foam Cleanser Face Makeup Remover Water Balancing Cleanser
$ 1 ~ $ 2
>=1000 Piece
Meo Food Co., Ltd.
Menior amino acids volcanic mud cleanser face washing bean 56pcs OEM
$ 2.5 ~ $ 4.5
>=1 boxe
Meo Food Co., Ltd.
New China Products Organic Face Wash Facial Cleanser Anti Dust Mite Amino Acid Soap With Wholesale Price
$ 3
>=116 Box(es)
Meo Food Co., Ltd.
Private Label Black Head Tea Tree Snail Man Vitamin c Face Wash new Cream Charcoal Facial Glycolic Acid Cleanser
$ 0.8 ~ $ 1.5
>=100 Piece
Meo Food Co., Ltd.
Natural Deep Cleaning and Nourishing Bamboo Charcoal Wash Facial Cleanser
$ 0.8 ~ $ 1.8
>=1000 Piece
Meo Food Co., Ltd.
Skin care exfoliating cleaner Amino Acid face wash foam facial cleansing mousse
$ 1.2 ~ $ 1.98
>=500 Piece
Meo Food Co., Ltd.
Private Label face foam natural facial cleanser deep cleaning hydration 2in1 Makeup Remover Mousse
$ 2.31 ~ $ 2.85
>=11 piec
Meo Food Co., Ltd.
OEM/ODM Anti Aging Wrinkle Reducing Exfoliating Tea Tree Foaming Face Wash Clear Pores on Oily Foam Cleanser
$ 2.1 ~ $ 2.75
>=1000 boxe
Meo Food Co., Ltd.
Odm/Oem Wholesale Customized Brand Cooling Face Wash And After Shave Cream In Toiletry Bag For Men
$ 3
>=1000 piec
Meo Food Co., Ltd.
Wholesale Amino Acid Color Bean Anti acne Foaming Face Pore Cleanser Oil Control Facial Cleanser
$ 2.58 ~ $ 4.28
>=3 Set
Meo Food Co., Ltd.
Private Label Face Wash with Rose Hip Natural Brightening Vitamin C Facial Cleanser
$ 1.49 ~ $ 1.79
>=1000 Piece
Meo Food Co., Ltd.
Private Label Best Selling High Effect Whitening Turmeric Face Wash
$ 1 ~ $ 5
>=1000 Piece
Meo Food Co., Ltd.
Private Label Skin Deeply Cleansing Face Wash Whitening Facial Cleanser for Men
$ 1.3 ~ $ 1.9
>=500 Piece
Meo Food Co., Ltd.
2020 Men's amino acid Face Wash For Dry Skin Deep Cleansing men care face wash Intimate wash for men
$ 0.5 ~ $ 1.12
>=2000 Piece
Meo Food Co., Ltd.
Wholesale quality Chinese products lemon oil control deep cleansing anti blackhead face wash for men
$ 0.9 ~ $ 1
>=2 Piece
Meo Food Co., Ltd.
Customized Private Label Wholesale OEM ODM Natural Organic Woman Face Cleanser VC Face Wash
$ 0.79 ~ $ 0.99
>=5000 Piece
Meo Food Co., Ltd.
Powder Natural mens face cleanser charcoal face wash
$ 1.1 ~ $ 3.5
>=1000 Piece
Meo Food Co., Ltd.
Professional Oil Control Men Facial Cleaning Wash
$ 2 ~ $ 2.35
>=10 Piece
Meo Food Co., Ltd.
CICABEL Amino Acid Peptides Soft Facial Cleanser Moisturizing Skin Care Deep Cleaning Face Wash
$ 5 ~ $ 9
>=3 boxe
Meo Food Co., Ltd.
2020 New Arrival Men Beauty Face Wash Wholesale OEM Mens Skin Care
$ 2.78 ~ $ 3.29
>=1 Piece
Meo Food Co., Ltd.
Professional skin care face pore cleansing balm blackhead cleanser makeup remover for sensitive skin
$ 2.86 ~ $ 3.36
>=1000 Piece
Meo Food Co., Ltd.
Private Label Facial Cleanser Oolong Tea Foaming Face Wash Vegan and Gentle Formula Face Cleanser
$ 1.79 ~ $ 1.89
>=1000 Piece
Meo Food Co., Ltd.
Best Recommended men Facial Cleanser OEM Customized men Deep cleaning face wash exfoliator mousse men face care
$ 1.47 ~ $ 1.81
>=1 boxe
Meo Food Co., Ltd.
Related Searches:
shiseidofacewashbestwhiteningfacewashmensfacewashforoilyskinbodyshopteatreeoilfacewashtopfacewashformenbiothermfacewashbestmen'sfacewash2018proactivdeepcleansingwashniveafacialfoamdovefacialcleanserteatreefoamingfacewashacnefreefacewashmarykayfacewashoilofolayfacewashbestcleanserforcombinationskinhydratingfacewashbestfacesoapelectricfacialcleansergarnierskinactivemicellarfoamingfacewashbestoilcontrolfacewashformensbestfacewashforacneanddryskinfacewashneutrogenadeepcleanfacewashbestfacewashforsensitivecombinationskinpondsfacewashfordryskinaminoacidcleanserneutrogenacleanserforoilyskinhadalabogokujyunfacewashbestoilcontrolfacewasheltamdcleanser