Welcome to TradeChina
-
RELATED CATEGORIES:
2020 Hot Sale small capacity double stainless steel vacuum insulated baby water bottle kids
$ 5.5 ~ $ 6.5
>=100 Piece
Meo Food Co., Ltd.
BPA Free 60g & 30g Customized Logo Sticker Label Portable Protein Container Supplement Protein Powder Funnel With Keychain
$ 0.79 ~ $ 1.01
>=1000 Piece
Meo Food Co., Ltd.
C011 Factory Supply Portable Small Travel Mugs Stainless Steel Water Bottles Bulk
$ 3 ~ $ 4.5
>=100 Piece
Meo Food Co., Ltd.
400ml BPA Free Environmental Eco friendly Degradable Wheat small Protein Shaker Water Bottle with straw For Sports Gym
$ 0.98 ~ $ 1.1
>=1000 Piece
Meo Food Co., Ltd.
1000ml transparent drinking milk carton water bottle plastic kawai shape
$ 2 ~ $ 2.4
>=2 piec
Meo Food Co., Ltd.
Zogift Factory promotion New design Transparent Portable water bottle for chinese supplier
$ 0.54 ~ $ 0.71
>=100 Piece
Meo Food Co., Ltd.
supermarkets decorative yoghurt wine coffee teacup ice creams mineral water milk coke resin miniature bottle
$ 0.01 ~ $ 0.2
>=20 Piece
Meo Food Co., Ltd.
Wholesale Customized Creative Korean Mini cute glass fresh simple portable small water cup
$ 2.97 ~ $ 3.69
>=2 Piece
Meo Food Co., Ltd.
Fangjuu Bottom Price Latest Design Portable Plastic Tea Cup Pink Iced Cartoon Plastic Water Bottle
$ 1.97 ~ $ 2.95
>=10 Piece
Meo Food Co., Ltd.
Fangjuu Wholesale New Design Outdoor Plastic Tea Cup Silicone Lid Cute Painted Plastic Water Bottle
$ 2.97 ~ $ 3.76
>=10 piec
Meo Food Co., Ltd.
cake craft portable plastic 18ml small plastic bottle spray powder
$ 0.5 ~ $ 0.8
>=5000 Piece
Meo household Co.LTD
Custom Made Square Shape Small Glass Bottle With Pump Colorful Car Perfume Bottles
$ 0.06 ~ $ 0.13
>=50000 Piece
Meo household Co.LTD
Mini Sisal Trees Artificial Small Christmas Trees Bottle Brush Brown Wood Table Top Tree Craft for Christmas Decoration
$ 0.52 ~ $ 1.07
>=2 Piece
Meo Food Co., Ltd.
30ml 50ml 60ml 80ml 120ml 160ml 240ml plastic pharmaceutical medicine capsule vial pill bottle
$ 0.05 ~ $ 0.09
>=500 Piece
Meo household Co.LTD
60ML bubble toys plastic summer outdoor bubble bottle
$ 0.09 ~ $ 0.19
>=30000 Piece
Meo Food Co., Ltd.
1325 100w wholesale liaocheng best sale wood craft cutting and ruber fiber stamp carving machine for mdf plastic jewelry sheet
$ -
>=1 Set
Meo Textile Clothing Co.LTD
In stock plastic white small 2oz food grade squeeze bottle and red tip caps
$ 0.02 ~ $ 0.04
>=2000 Piece
Meo household Co.LTD
Small Beer Bottle Bottling Craft Beer Brewery Production Line Filling Plant Beer Equipment
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Small Craft Beer Filling Machine Counter Pressure Bottle Filler For Glass Bottle
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Wholesale Automatic Hot for walking portable plastic travel recycling dispense 350ml 550ml Pet dog water bottle
$ 3.6 ~ $ 4.4
>=20 Yard
Meo Food Co., Ltd.
Hot sell walking portable plastic travel recycling dispenser 300ml Pet dog water bottle
$ 3.99 ~ $ 4.62
>=100 piec
Meo Food Co., Ltd.
Yoyo Small Refillable Liquid Containers Portable Travel Bottles Set with Retractable Reel Clip
$ 0.69 ~ $ 0.99
>=50 Unit
Meo Electronic Technology Co.LTD
Small-Caliber Glass Bottle Bayonet Small Vial Pendant with Cork Plastic Lids
$ 0.01 ~ $ 0.04
>=3000 Piece
Meo household Co.LTD
High technology beer glass bottle b filler plant for small beer filling machine /1000BPH Craft Beer Glass bottle Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
MUB 1 ml glass bottles of perfume small sample perfume bottle , vial bottle with plastic tube
$ 0.01 ~ $ 0.03
>=10000 Piece
Meo household Co.LTD
Wholesale Clear Transparent Empty Mini Small 2oz 4oz 20ml 30ml 50ml 60ml 100ml Perfume Fine Mist pressure spray bottle
$ 0.2 ~ $ 0.32
>=1000 piec
Meo Food Co., Ltd.
Plastic bottle recycle fiber felt modern children small rectangle dining tables and desks for living room
$ 17 ~ $ 18.3
>=200 piec
Meo Food Co., Ltd.
Reusable Baguette bread Bag Premium Unique Made from Recycled Plastic Bottles Freezer Safe Food Storage with Double Lining
$ 1.6 ~ $ 2
>=1000 Piece
Meo Electronic Technology Co.LTD
Milkshake Protein Shaker Ball For Small Bottle,Food Grade Stainless Steel Wire Mixer Mixing Ball For Small Shaker
$ 0.1 ~ $ 0.6
>=50 piec
Meo Textile Clothing Co.LTD
Gift Box with Ribbon Closure Box for Gift Craft Birthday Gifts for Husband Banknote Security Custom Silver Jewelry Baby Shoe
$ 3.72
>=2 Piece
Meo household Co.LTD
Small Iron Bottle party popper
$ 0.36 ~ $ 0.37
>=3000 piec
Meo Food Co., Ltd.
Cheap waterproof ice bag wine eco friendly transparent plastic reusable pvc wine bottle gift bag
$ 0.15 ~ $ 0.5
>=1000 Piece
Meo Electronic Technology Co.LTD
NEW high quality beer canning avoiding bubbles low price small beer can bottle filling machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
3m factory price indoor artificial small bottle Coconut palm tree
$ 138 ~ $ 155
>=3 piec
Meo Food Co., Ltd.
small beer champagne drifting bottle plastic candy box
$ 0.45
>=5000 Piece
Meo household Co.LTD
6-6-1 Glass Bottle Craft Beer Filling Machine / Small Scale Brew Bottling Plant
$ -
>=1 Set
Meo Textile Clothing Co.LTD
hot sale small Champagne Bottle Party Popper
$ 0.6 ~ $ 0.65
>=3000 Piece
Meo Food Co., Ltd.
Small DIY Christmas Tree Pine Tree Mini Sisal Bottle Brush Christmas Tree Santa Snow Frost Village House Five Size
$ 2.2 ~ $ 2.5
>=100 piec
Meo Food Co., Ltd.
Chinese Feng Shui Bronze Bell with Plastic Elephant & Baby Car Rear View Mirror Decor Patio Balcony Yard Buddha Lucky Hanging
$ 1.29 ~ $ 1.93
>=12 piec
Meo Food Co., Ltd.
30 ml 50 ml small paper jar Packaging for cosmetic plastic jar paper tube packaging
$ 0.9 ~ $ 1.2
>=1000 piec
Meo household Co.LTD
Screw Top CLEAR Lid Pots/Jars - Beads, Glitter, Nail Art, CRAFT storage small container
$ 0.15 ~ $ 0.35
>=500 Piece
Meo household Co.LTD
Small Jar Resin Molds with Lid Silicone Epoxy Casting Mold for Small Bottle DIY Mini Jewelry Container Storage Trinket Box
$ 1.3 ~ $ 1.8
>=500 piec
Meo Food Co., Ltd.
Kenya agent nonmetal products crystal wood bottle plexiglass 1390 1610 500w lift table small laser engraving machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
small 6040 50w co2 laser tube laser cutter leather craft engraving cutting machine Wine Bottle Cylinder Wood Co2 Laser Engraving
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory direct sale cheap price craft small bead alphabet recyclable plastic beads,wholesale high quality colorful plastic beads
$ 2
>=500 Piece
Meo Electronic Technology Co.LTD
Multipurpose Small Plastic Clips Colorful Cloth Clips for Sewing Patchwork Crafts With A Jar Packing
$ 0.03 ~ $ 0.05
>=20 Piece
Meo household Co.LTD
Clear Biodegradable Mini Pet Plastic Juice Bottle Cold Press Coffee Drinking 100ml 200ml 250ml 350 ml Plastic Bottle For Juice
$ 0.35 ~ $ 0.8
>=50 Piece
Meo household Co.LTD
1 or 2 g powder small mini gold transparent acrylic 1 gallon plastic bottle for health care product packaging
$ 0.2
>=1000 piec
Meo household Co.LTD
4.2m factory price indoor outdoor artificial small bottle Coconut palm tree
$ 300 ~ $ 310
>=3 piec
Meo Food Co., Ltd.
0.5g saffron bottle small hexagon vial pigment bottles
$ 0.15
>=1000 Piece
Meo household Co.LTD
Related Searches:
craftsmadefromplasticbagscraftstringplasticwaterbottlecraftsforpreschoolplasticformakingstencilsdiybirdfeederwithplasticbottleeasycraftwithplasticbottleschristmascraftswithplasticcupsembroideryonplasticplasticcanvascraftsstencilsplasticplasticcanvasbytheyarddiyrecycledplasticbottleprojectsplasticlacingcordplasticcanvasplasticbottlecapcraftsplasticbottlecraftplasticcanvasmagnetsplasticbottlecapmagnetsplasticbagdiycraftsplastictapestrycanvasplasticcanvasforbeginnersplasticlacecraftsplasticlanyardcraftrecycledplasticweavingplasticbagcraftswhiteplasticcanvascraftswithplasticwaterbottleswaterbottlecraftsplasticbagmacrameboyeplasticcrochethooks