Welcome to TradeChina
-
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
robot coffee kiosk vending machine
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
RO Water Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machine
$ 130 ~ $ 138
>=10 piec
Meo Textile Clothing Co.LTD
Zhongda e-cigarette e cig Vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheapest easy use commercial coffee vending machine
$ 290 ~ $ 460
>=10 piec
Meo Textile Clothing Co.LTD
GTS305T Fitness Equipment Coffee Vending Machine Energy Protein Shake Vending Machine Protein Drinks & Coffee Drinks
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
TCN hot selling automatic coffee vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
New Design Commercial Capsule Espresso Coffee Vending Machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Oem/odm Combo Snack China Manufacturer Instant Powder Business Wholesale Coffee Vending Machine In Philippines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Mini Simple Small Size Cheap Snacks Fresh Milk Can Coin Operated Purified Water Coffee Vending Machine Business For Sale
$ 20 ~ $ 70
>=500 Set
Meo Textile Clothing Co.LTD
Touch Screen Fresh Bean Business Coffee Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Hot Coffee Tea Chocolate Table Top Fully Automatic Coffee Vending Machine
$ 230 ~ $ 400
>=2 Set
Meo Textile Clothing Co.LTD
10 touch button office use instant coffee vending machine ,used instant coffee vending machine price ,instant coffee te WF1-404B
$ 210 ~ $ 300
>=1 Piece
Meo Textile Clothing Co.LTD
Coffee Milk Tea Black Combo Self-service Vending Machine with 2020 New Style
$ 992 ~ $ 996
>=1 Unit
Meo Textile Clothing Co.LTD
Premium espresso coffee machine milk tea vending machine tea time coffee vending machine WF1-303A
$ 160 ~ $ 200
>=1 piec
Meo Textile Clothing Co.LTD
2019 New Business Cheap Small WiFi Coffee Beans Vending Machine Maquina Expendedora De Cafe
$ 372 ~ $ 389
>=1 Unit
Meo Textile Clothing Co.LTD
Smart electronic combo touch screen vending machine manufacturer/coffee vending machine with conveyor belt vending business
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin operated Candy vending machine, metal vending machine, capsule vending machine
$ 35 ~ $ 45
>=1 Piece
Meo Textile Clothing Co.LTD
Business Use Espresso vending Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
Alibabaselect custom black vending machine / venting machine for vape snack food and drink beverage business in philippines
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Self-Service Espresso Coffee Vending Machine With 21.5 Inch LCD Touch Screen Display
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
TCN children chocolate coffee vending machine business for office
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Desktop Coffee Vending Machine Fully Automatic Commercial with Cup Auto Dispense
$ 240 ~ $ 370
>=2 Set
Meo Textile Clothing Co.LTD
Christmas new professional Smart cocktail machine commercial coffee machine bartender equipment
$ -
>=1 Pack
Meo Food Co., Ltd.
10 mixing flavors Fully automatic mocha espresso milk coffee vending machine WF1-505B
$ 240 ~ $ 320
>=1 piec
Meo Textile Clothing Co.LTD
Commercial Fully automatic korean coffee machine for business
$ 320 ~ $ 380
>=1 piec
Meo Advertising Co.LTD
Sapoe professional business table top coins coffee tea soup vending machine
$ 1 ~ $ 245
>=50 Piece
Meo Textile Clothing Co.LTD
2017 Hot sale and low price bulk candy vending business ZJ330, ZJ325, ZJ320
$ 45 ~ $ 47
>=10 piec
Meo Textile Clothing Co.LTD
Mini Bottle Water Self Service Business Wall Mount Snack Coffee Vending Payment Machine Small Sanitary Lcd Display
$ 20 ~ $ 70
>=500 Set
Meo Textile Clothing Co.LTD
Mini business table top coin operated coffee vending machine
$ 230 ~ $ 400
>=20 Unit
Meo Textile Clothing Co.LTD
Amazon top seller 30oz insulated rtic growler tumbler cups pipe hot food vending machines copper coffee jug mug
$ 4.7 ~ $ 4.9
>=1000 Piece
Meo Food Co., Ltd.
5 hot /cold drinks Coffee/hot chocolate/Cafe Vending Machine Professional Instant Coffee Vending machine WF1-505A
$ 240 ~ $ 320
>=1 Piece
Meo Textile Clothing Co.LTD
high quality automatic espresso capsule coffee maker coffee machine
$ 46 ~ $ 59.8
>=1 piec
Meo Advertising Co.LTD
Yile Bean Coffee Vending Expendedora De Cafe Machine with Cup Dispenser
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Coin and Bill Acceptors Cold Protein Shake Vending Machine with Cloud Management
$ -
>=1 Set
Meo Textile Clothing Co.LTD
fast food kiosk coffee vending machine coffee shop TRUCK TRAILER
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic coin-operated type Instant Powder Coffee Machine business use coffee vending machine
$ 220 ~ $ 320
>=1 piec
Meo Textile Clothing Co.LTD
Vending Machine Of 12 With Insert Push Up Holder Cajas Personalizadas Domos Para Wholesale Transparent 4 Board Cupcake Box Cake
$ 0.02 ~ $ 0.03
>=5000 Piece
Meo Food Co., Ltd.
Sapoe business table top mini commercial vendor coffee machine with coin slot
$ 1 ~ $ 200
>=50 oem
Meo Textile Clothing Co.LTD
3 Selection Flavor Orange Juice Tea Vending Machine Desktop Instant Coffee Maker
$ 200 ~ $ 350
>=1 Set
Meo Textile Clothing Co.LTD
WECARE Hot sale food cart business mobile coffee pizza trailer hot dog cart with CE
$ -
>=1 Set
Meo Textile Clothing Co.LTD
best coffee machine 2020 /commercial coffee vending machine
$ -
>=1 Piece
Meo Advertising Co.LTD
2019 hot sale vw food truck shawarme food truck vending food cart coffee trailer
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Coffee Vending Machine With Coffee Grinder Popular Coffee Machine
$ 300 ~ $ 380
>=50 Set
Meo Advertising Co.LTD
2 in 1 function commercial coffee vending machine Espresso cappcino maker bean to cup coffee machine
$ 72 ~ $ 88
>=2 Piece
Meo Advertising Co.LTD
Factory Direct 21.5" Touch Screen Coffee Vending Machine
$ 199 ~ $ 228
>=1 Unit
Meo Advertising Co.LTD
China gourmet food trucks for sale / food cart franchising business coffee vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
19 capacitive touch screen application coffee vending machine
$ 216 ~ $ 286
>=1 Set
Meo Advertising Co.LTD
Related Searches:
quartercandymachinenestlecoffeevendingmachinebusinesseslookingforvendingmachinesrunningavendingmachinebusinesssolarpoweredvendingmachinefrozenfoodvendingmachinesmechanicalvendingmachineintelligentvendingmachinevendingmachinelocatorssoftdrinkmachinepriceatlantiscoffeevendingmachinevintagevendingcandyvendingmachinebusinessfrozenvendingmachinesnacksvendingmachinepriceeyelashvendingmachinecakevendingmachinehotvendingmachinestopvendingmachinecompaniescoinoperatedcandydispenserskittlesvendingmachineforsaletoycapsulemachineminipopmachinevendingmachineplacementmeivendingmachinebestcoffeevendingmachinesgachavendingmachinecolavendingmachinepeanutvendingmachinebestsellingvendingmachinecandy