Welcome to TradeChina
-
Indoor Electric Shock Uv Led Light Mosquito Killer Zapper Lamp Anti Insect Fly Trap Pest Control Bug Zapper
$ 9
>=2 piec
Meo Food Co., Ltd.
UV Insect Zapper Mosquito Killer Bug Trap Electric Pest Control
$ 7.6
>=1 Piece
Meo Food Co., Ltd.
2021 Indoor Capture Humane Plastic Electronic Rodent Traps,Smart Mouse Catcher Multi Rat Killer Chipmunk Mice Pest Mole Zapper
$ 5 ~ $ 12
>=1 Piece
Meo Food Co., Ltd.
Double Speaker Electronic Ultrasonic Pest Reject Repeller Rats Mice Rodents Repellent Anti Cockroach Mosquito Pest Control
$ 6.8 ~ $ 10
>=1 piec
Meo Food Co., Ltd.
JB20E UV LED Lamp Ultra Slim Freight Saving Mosquito Repellent Insect Killer Bug Zappers
$ 6 ~ $ 7.5
>=5 piec
Meo Food Co., Ltd.
Greathouse GH-190 Shenzhen Electronic Product Indoor Electromagnetic Rat Killer Machine Rat zapper Made In China
$ 11.5 ~ $ 12
>=99 piec
Meo Food Co., Ltd.
Insect Killer Bug Zapper IP24 Waterproof Electric Mosquito Killer Trap Lamp Charger OEM Box Logo
$ 1.2 ~ $ 2.8
>=1 Set
Meo Food Co., Ltd.
Custom electronic ultrasonic bug zapper mosquito pest repeller killer lamp plug-in plug in indoor
$ 0.7 ~ $ 1.2
>=200 piec
Meo Food Co., Ltd.
2019 New induction bug zapper cockroach mice rodent pest plug in repellent
$ 2.96 ~ $ 3
>=100 piec
Meo Food Co., Ltd.
Rechargeable Electronic Mosquito Killer Bat,Cockroaches Insect Zapper with 1LED & 5* LED Torch
$ 1.92
>=3000 piec
Meo Food Co., Ltd.
High Effective Cockroach Killer Harmless insect Zapper& Indoor Pest Control Trap
$ 0.2 ~ $ 1.2
>=100 piec
Meo Food Co., Ltd.
Ultrasound cockroach control repeller Tornado OTAR.01
$ 11.85 ~ $ 12.36
>=410 Piece
Meo Food Co., Ltd.
AA battery operate electric mosquito killer trap/fly killer bat/bug zapper
$ 1.33 ~ $ 1.41
>=1 Piece
Meo Food Co., Ltd.
2020 The most powerful Insect Killer Lamp mosquito fly bug zapper
$ 7 ~ $ 8
>=10 piec
Meo Food Co., Ltd.
Electric Fly Mosquito Swatter Mosquito Killer Bug Zapper Pest Control Battery Power
$ 1.18 ~ $ 1.25
>=1 piec
Meo Food Co., Ltd.
indoor insect zapper lampe anti moustique atrapa raqueta mata moscas electric moskito killing mosquito killer light
$ 4 ~ $ 9.2
>=20 Set
Meo Food Co., Ltd.
2020 newest Indoor LED Electric Mosquito Fly catcher Bug Insect Killer Night Lamp Trap Zapper
$ 4.12 ~ $ 5.65
>=100 piec
Meo Food Co., Ltd.
Mosquito Bug Zapper Swatter Rechargeable Mosquito Racket Electric Fly Killer Racket
$ 1.3 ~ $ 2.88
>=100 Piece
Meo Food Co., Ltd.
Handheld Insect Bug Zapper Fly Home Electric Mosquito Swatter Cordless Killer Lamp Racket 2 In 1 Pest Control USB Rechargeable
$ 3.5 ~ $ 4.4
>=40 Piece
Meo Food Co., Ltd.
New design dual control mouse trap bed bug pest repeller EU UK US plug bug zapper
$ 2.8 ~ $ 3
>=50 piec
Meo Food Co., Ltd.
HYD-40 Series BV certificate approved battery-operated mosquito swatter bug zapper mosquito racket
$ 1 ~ $ 1.1
>=3000 Piece
Meo Food Co., Ltd.
2020 Top seller Mosquito killingswatter Two in One Usb cable electrical house fly killer mosquitos swatter racket zapper
$ 4.97 ~ $ 7.97
>=2 piec
Meo Food Co., Ltd.
X-Pest MK01 Indoor Bug Zapper Fly Trap Mosquito Killer Trap LED Electronic Insect Pest Killer Night Lamp
$ 3.85 ~ $ 4
>=3000 Piece
Meo Food Co., Ltd.
Latest best mosquito killer wall fly zapper for house
$ 8 ~ $ 11.5
>=1000 Piece
Meo Food Co., Ltd.
GH-200C indoor electric bug zapper electric bug zapper racket electric bug zapper
$ 6.5
>=500 Piece
Meo Food Co., Ltd.
X-PEST amazon hot sales MK02 360 degree protection 395nm UVA light DC 5V mosquito killer electric mosquito bug zapper
$ 8.32 ~ $ 8.52
>=1000 piec
Meo Food Co., Ltd.
Electric Mosquitoes Killing Lamp Light Mosquito Trap Bug Zapper Indoor with LED Strong Fan Suction
$ 1.85 ~ $ 2.14
>=2 piec
Meo Food Co., Ltd.
Home Use Effitive Ultrasonic Mosquito repeller Mice Bugs Repellent Plug In Ultrasonic Pest Repeller And Insect Zapper
$ 2.9 ~ $ 3.5
>=100 piec
Meo Food Co., Ltd.
Bug Zapper Mosquito Killer - Mosquito Trap Lamp Non-toxic LED Insect Pest Bug Mosquito Zapper
$ 4.79 ~ $ 5.99
>=100 Piece
Meo Food Co., Ltd.
HOT SELLING UV LED Bug Zapper 3 W high effective Insect Killer Mosquito Trap for indoor
$ 2.6
>=1000 Piece
Meo Food Co., Ltd.
X-PEST Cheap Price Electric Rotation Fan Mosquito Killer Lamp Insect Killer Trap Bug Zapper USB Powered Mosquito Killer Lamp
$ 5.5 ~ $ 6.2
>=2 piec
Meo Food Co., Ltd.
Bed Mite Zapper Repeller ultrasonic pest control bug repeller
$ 4.2
>=2000 piec
Meo Food Co., Ltd.
2020 New Trending Electric Harmless Skin Bug Zapper Racket Rechargeable Mosquito Racquet Killer
$ 6.1 ~ $ 6.15
>=15 piec
Meo Food Co., Ltd.
2 AA Batteries Operated Hand Racket Electric Mosquito Swatter Insect Home Garden Fly Mosquito Zapper
$ 2.65 ~ $ 3.15
>=100 piec
Meo Food Co., Ltd.
Advanced 365-395 Nm Wave With Led Light Electronical Bug Zapper Anti Mosquito Killer Lamp
$ 1.9 ~ $ 2.98
>=1 Piece
Meo Food Co., Ltd.
Factory price ultrasonic pest repeller indoor plug in bug zapper EK001
$ 0.3 ~ $ 1.1
>=50 Bag(s)
Meo Food Co., Ltd.
30W ultraviolet Insect killer lamp Trap Zapper Kill mosquito lamp electric shock mosquitoes killer fly catcher machine
$ 10.73 ~ $ 12.38
>=100 piec
Meo Food Co., Ltd.
Ultrasonic pest repeller/insects /pest zapper
$ 1 ~ $ 5
>=1 Piece
Meo Food Co., Ltd.
US UK EU Plug Ultrasonic Pest Repeller Mosquito Killer Plug in Electronic Repellent Anti Rodent Mice Cockroach Rat Spider Insect
$ 0.9 ~ $ 2
>=10 piec
Meo Food Co., Ltd.
Indoor rechargeable repellent electric mosquitoes trap Flying Insect Repellent Trap Bug Zapper
$ 5.2 ~ $ 7
>=2 piec
Meo Food Co., Ltd.
UV tube/LED Electronic Ballast Bug Zapper Insect Killer Mosquito Trap Fly Catcher Pest Control Electric Mosquito Killer Lamps
$ 10 ~ $ 15
>=2 piec
Meo Food Co., Ltd.
electric fly insect killer bug zapper
$ 2.5 ~ $ 3.5
>=300 piec
Meo Food Co., Ltd.
new design high quality electric mosquito swatter termite bug zapper
$ 2.5 ~ $ 3
>=2000 piec
Meo Food Co., Ltd.
QX-001 AC charging BS Charging Mosquito Bat One Pic Raqueta Mata Moscos Bug Zapper Racket Electric Mosquito Racket Insect
$ 1.48 ~ $ 1.6
>=1000 piec
Meo Food Co., Ltd.
2AA Battery Mosquito Swatter Bug Zapper Electrical Mosquito Racket
$ 0.9 ~ $ 1
>=3000 Piece
Meo Food Co., Ltd.
Bed Bug Zapper Newest Safe Bedroom Dust Mite Zapper
$ 4.45 ~ $ 4.55
>=2000 piec
Meo Food Co., Ltd.
Electric Indoor Mosquito Trap Mosquito Killer Lamp with USB Power Supply and Adapter Suction Fan No Zapper Super Silent Suitable
$ 2.5 ~ $ 2.8
>=1 piec
Meo Food Co., Ltd.
00702001 New Design Mosquito Killer Lamp Hot Selling Bug Zapper Fly Killer Photocontact Enzyme Fan Mosquito - Absorbing Lamp
$ 1.88 ~ $ 2.1
>=200 piec
Meo Food Co., Ltd.
Pest Control Ultrasonic Pest Repeller Mosquito Killer Electronic Anti Rodent Insect Repellent Mole Mouse Cockroach Mice
$ 6.7 ~ $ 13
>=1 piec
Meo Food Co., Ltd.
9W 15W 20W Mosquito Lamp Killer Repellent Trap Lamps LED Lighting Bulb Pest Control Bug Zappers Lights Moskiller
$ 0.15 ~ $ 1.5
>=20 Piece
Meo Food Co., Ltd.
Related Searches:
colemanbugzapperbestelectricflyzapperbugzapperpricesolarbugzapperbestindoorflyzapperstingermosquitokillerhandbugzapperpluginflyzapperelectronicwaspkillerelectricflyracketflyzapperlightrechargeablemosquitokillerbestbuybugzappermosquitokillerlightoutdoorinsectzapperbatteryoperatedmosquitokillerflykilleramazonbestbugzapper2018portablemosquitozapperbesthandheldbugzappertheexecutionerbugzappercheapbugzappertopratedbugzapperhandheldflyzapperco2bugzappersolarinsecttrappricediymosquitozapperbugzapperforsalenearmeflyswatterelectricracketsolarpoweredmosquitokiller