Welcome to TradeChina
-
YJ-DEREK Vehicle Auto Vehicle Vinyl Wrap Glossy/Matte Chameleon Car Viny Sticker
$ 190 ~ $ 200
>=1 Roll
Meo Bio Energy Sales Co.LTD
Strength Film LLDPE clear transparent high quality stretch film stretch wrap for pallet wrapping and packaging machine grade jum
$ 1.2 ~ $ 2
>=1000 Roll
Meo household Co.LTD
Clear Pallet Wrap on Extended Core
$ 1.5 ~ $ 2
>=1 Kilogram
Meo household Co.LTD
High quality rectangular and square packaging custom clear pof heat shrink wrap bags
$ 0.02 ~ $ 0.05
>=1000 Piece
Meo household Co.LTD
Wholesale Custom Hand Stretch 18"x 1500ft Clear Plastic Wrap Jumbo Film For Pallet
$ 6.48 ~ $ 6.58
>=100 Roll
Meo household Co.LTD
Annhao1.52*18m Glossy and Matte White Chameleon Car Vinyl Wrap
$ 110 ~ $ 120
>=1 Roll
Meo Bio Energy Sales Co.LTD
heavy duty customized white opaque car wrap with non-woven liner
$ 2 ~ $ 3
>=1000 Kilogram
Meo Bio Energy Sales Co.LTD
Best Quality Color Change Wrap Car Pearl Chameleon Vinyl Roll
$ 1 ~ $ 2.9
>=1000 square meter
Meo Bio Energy Sales Co.LTD
Custom design high quality advertising vinyl Vehicle Wraps for vans/bus
$ 7.3 ~ $ 8.8
>=10 square meter
Meo Bio Energy Sales Co.LTD
TPU Materials Anti-yellow Self -healing 5 Years Warranty Car Paint Protective Film Clear Wrap Full Body Protection
$ 560 ~ $ 600
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m PVC PPF Anti Scratch Car Paint Protection Vinyl Wrap Film for Car
$ 60 ~ $ 75
>=1 Roll
Meo Bio Energy Sales Co.LTD
Grey Vinyl Car Wrap for digital printing eco solvent printing vinyl using on cars / buses
$ 1.2 ~ $ 1.4
>=3000 Roll
Meo Bio Energy Sales Co.LTD
NARPPF high quality Anti-scratch ppf car transparent protective film body wrap TPU 1.52*15m
$ 640 ~ $ 680
>=1 Roll
Meo Bio Energy Sales Co.LTD
Anti-Scratch Resistance Transparent Clear Matt Car Protection Wrap Vinyl Sticker Roll Self Healing Paint Protective Film TPU PPF
$ 486 ~ $ 550
>=2 Roll
Meo Bio Energy Sales Co.LTD
Matte Vinyl Wrap with Bubble Free
$ 70 ~ $ 120
>=1 Roll
Meo Bio Energy Sales Co.LTD
clear color nano adhesive Transparent 3D Carbon Fiber Vinyl Wrap
$ 1.1 ~ $ 2
>=100 Roll
Meo Bio Energy Sales Co.LTD
Auto paint protective film high stretchable anti yellow PPF clear body matte paint protection film on cars with self healing
$ 128
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m high quality anti scratch Transparent Car Paint Protection Film Sticker PPF
$ 380 ~ $ 580
>=2 Roll
Meo Bio Energy Sales Co.LTD
Clear Static film pvc electrostatic protective wrapping film printing film for helmet labels on the car label
$ 0.98 ~ $ 1.52
>=3000 Meter
Meo household Co.LTD
Guangzhou Eagle OEM Self Adhesive Carbon Fiber Paper For Car
$ 82 ~ $ 199
>=1 Roll
Meo Bio Energy Sales Co.LTD
High quality 30cm*10m removable vehicle vinyl car tail and headlight wrap chameleon tint film
$ 10 ~ $ 11
>=12 Roll
Meo Bio Energy Sales Co.LTD
Self Adhesive Vinyl Car Wrap Paper Printable Inkjet Paint Transparent PVC Clear Film Car Vinyl Sticker
$ 0.48 ~ $ 0.89
>=30 square meter
Meo Bio Energy Sales Co.LTD
water-proof protect damaged areas on vehicles or other equipment 4 Mil self-adhesive film
$ 0.07 ~ $ 0.25
>=10000 Meter
Meo household Co.LTD
Factory price Super Glossy Transparent Invisible vynil TPH Paint Protection Car Film roll tpu wrapping car paint protection film
$ 5.9 ~ $ 6.2
>=5000 Meter
Meo Bio Energy Sales Co.LTD
PVC Car surface paint protection film transparent car vinyl wrap ppf 1.52*15m
$ 60 ~ $ 75
>=1 Roll
Meo Bio Energy Sales Co.LTD
High clear nano ceramic car window vinyl 1.52*30m glass protective film stop heat
$ 180 ~ $ 250
>=1 Roll
Meo Bio Energy Sales Co.LTD
3D Carbon Transparent Vinyl Wrap Twill Weave Adhesive Film Vinyl Stickers
$ 1.1 ~ $ 2
>=100 Roll
Meo Bio Energy Sales Co.LTD
3d clear plastic cutting logo vehicle bonnet window transfer vinyl decal windshield bumper side body wrap car decoration sticke
$ 0.02 ~ $ 0.03
>=100 piec
Meo household Co.LTD
Car Paint Protection Film Vinyl for advertising wrap Auto-Repair PPF Double Coating Clear TPH material.
$ 135 ~ $ 165
>=29 Roll
Meo Bio Energy Sales Co.LTD
KPAL for car wholesale Self healing anti scratch clear gloss tpu car protection film
$ 310 ~ $ 330
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52x15m Removable Car Body Wrap Transparent Protective Vehicle Clear Vinyl
$ 50 ~ $ 99
>=1 Roll
Meo Bio Energy Sales Co.LTD
car hood vinyl wrap sticker 3D clear vinyl Carbon fiber sticker for motorcycles laptops wrapping
$ 1.1 ~ $ 2
>=100 Roll
Meo Bio Energy Sales Co.LTD
high tenacity 210d/3 polyester thread
$ 0.73 ~ $ 1.12
>=500 piec
Meo Electronic Technology Co.LTD
New Product 2018 smart film car wrap White LCD glass make a price
$ 50 ~ $ 150
>=10 square meter
Meo Food Co., Ltd.
Transparent Static pvc electrostatic film High Quality Static Cling Window Vinyl Film Without Glue Residue for helmet label
$ 0.98 ~ $ 1.52
>=3000 Meter
Meo household Co.LTD
monofilament polyester yarn 50d for sandwich air mesh
$ 4.62 ~ $ 5.6
>=500 Kilogram
Meo Electronic Technology Co.LTD
Anti Scratch Best Quality Clear Nano Ceramic TPU PPF Car Wrap Vinyl Paint Protection Film For Car Body
$ 100 ~ $ 700
>=1 Roll
Meo Bio Energy Sales Co.LTD
Factory Directly supply 0.11mm pet polyester monofilament yarn
$ 3.23 ~ $ 3.88
>=500 Kilogram
Homelife
Three Sizes Professional Squeegee Car Wrap Tools For PPF Clear Films
$ 5.99 ~ $ 7.99
>=100 Set
Meo Food Co., Ltd.
factory sell 100D polyester monofilament yarn for hose wire
$ 4.25 ~ $ 4.99
>=500 Kilogram
Meo Electronic Technology Co.LTD
3 Years Warranty Gloss Self Adhesive Wrap Vehicle Auto-repaired Anti Scratch Car Body Clear Paint Protection TPU TPH PPF Film
$ 100 ~ $ 700
>=1 Roll
Meo Bio Energy Sales Co.LTD
Best Quality Clear Nano Ceramic TPU PPF Car Wrap Vinyl Paint Protection Film For Car Body
$ 1 ~ $ 560
>=1 Roll
Meo Bio Energy Sales Co.LTD
polyester monofilament 0.16mm crochet yarn for shoes
$ 2.98 ~ $ 3.88
>=500 Kilogram
Meo Electronic Technology Co.LTD
100%Polyester Knitting Yarn 80D Semi-dull Filter Yarn
$ 4.62 ~ $ 5.49
>=500 Kilogram
Meo Electronic Technology Co.LTD
Filter Screen Mesh 140D Monofilament Semidull 100%Polyester Yarn
$ 4.25 ~ $ 5.06
>=500 Kilogram
Meo Electronic Technology Co.LTD
Rigid PVC film for aluminum foil
$ 70 ~ $ 90
>=1 Roll
Meo Food Co., Ltd.
0.14mm PET Monofilament 100%Polyester Thread For Car Seat Cushion
$ 2.89 ~ $ 3.69
>=500 piec
Meo Electronic Technology Co.LTD
isacord thread embroidery 140D polyester yarn in indonesia
$ 3 ~ $ 4.98
>=500 Kilogram
Meo Electronic Technology Co.LTD
20*24cm Rhinestone Diamond Mesh Wrap Roll Rhinestones Trim Wedding Party Decorations
$ 4.58 ~ $ 19.5
>=2 Piece
Meo Electronic Technology Co.LTD
good tenacity 0.08mm polyester yarn for filters artificial hairs
$ 3.86 ~ $ 4.98
>=500 Kilogram
Meo Electronic Technology Co.LTD
Related Searches:
protectionfoilforcarscostofprotectivefilmoncar3mclearfilmforcarsbodyfencepaintprotectionfilmpaintprotectionfilmforsale3mtransparentfilmforcars3mclearbrainstaller3mcarshield3mpaintprotectioncoatingpaintprotectionfilmcarcostppfcarcostvehiclepaintprotectionfilmsuntekpaintprotectionbestautopaintprotectionfilmclearadhesivefilmforcarspaintprotectionnearmeclearcarprotectionfilminstallersbestpaintprotectionfilmforcarsxpelcarclearcarhoodprotectormattepaintprotectionfilmclearbracarinstallationnearmexpelppffilmcarclearbrainstallationnearmecarmaskingfilmclearvinylwrapcar3mprecutclearbrappfoncarxpelcarwrapnearmeautopaintprotectionfilminstallers