Welcome to TradeChina
-
60"x50" K10 Car Warp PPF TPU Auto Film Self-healing Paint Protection Film Clear Self Adhesive Vinyl Rolls PPF Car Sticker
$ 610 ~ $ 670
>=1 Roll
Meo Bio Energy Sales Co.LTD
YJ-DEREK Heat-healing Transparent Car Paint Protection Film Clear PPF/TPH With 0.12/0.15mm thickness
$ 110 ~ $ 120
>=1 Roll
Meo Bio Energy Sales Co.LTD
Factory High Gloss Clear bra 7.6mil Anti yellowing transparent self-healing car paint protection film PPF TPU
$ 380 ~ $ 420
>=1 Roll
Meo Bio Energy Sales Co.LTD
Transparent self healing scratch resistant VKOOL clear TPU PPF film body Sticker Car paint protection
$ 517 ~ $ 559
>=2 Roll
Meo Bio Energy Sales Co.LTD
Anti fouling Anti-yellow Auto Clear TPU Paint Protection Film
$ 650 ~ $ 799
>=1 Roll
Meo Bio Energy Sales Co.LTD
Matte Auto-repair Clear Car Paint Protection Film
$ 550 ~ $ 650
>=1 Roll
Meo Bio Energy Sales Co.LTD
Clear Transparence Waterproof TPU PPF film car paint protection
$ 330 ~ $ 380
>=1 Roll
Meo Bio Energy Sales Co.LTD
LUMI-S Premium Clear Custom High Quality Anti-gravel Car Paint Protection Film
$ -
>=1 Roll
Meo Bio Energy Sales Co.LTD
Car Protective film/Invisible Coating Film/Car body paint protection film
$ 155 ~ $ 160
>=100 Roll
Meo Bio Energy Sales Co.LTD
Top quality Self Adhesive Transparent Clear Car Wrapping sticker Roll car Paint Protection inslufilm film for auto protection
$ 155 ~ $ 215
>=1 Roll
Meo Bio Energy Sales Co.LTD
TPU Materials Anti-yellow Self -healing 5 Years Warranty Car Paint Protective Film Clear Wrap Full Body Protection
$ 560 ~ $ 600
>=1 Roll
Meo Bio Energy Sales Co.LTD
KPAL Cheap car body glossy auto protection protect paint clear film
$ 150 ~ $ 180
>=1 Roll
Meo Bio Energy Sales Co.LTD
paint protection film stick on the surface of car ppf tpu tph antiscratch ppf car body clear paint protection film
$ 98 ~ $ 136
>=1 Roll
Meo Bio Energy Sales Co.LTD
Car Body Paint Protection 1.52*15m High Quality Clear Film Transparent PVC Film
$ 35 ~ $ 45
>=1 Roll
Meo Bio Energy Sales Co.LTD
Top nano coated car paint protection PPF clear invisible hydrophobic film for car body protection
$ 105 ~ $ 155
>=1 Roll
Meo Bio Energy Sales Co.LTD
New technology transparent car paint protection film clear PPF film car paint protection
$ 289 ~ $ 369
>=1 Roll
Meo Bio Energy Sales Co.LTD
High Quality Clear Nano Ceramic TPU PPF Car Wrap Vinyl Paint Protection Film For Car Body
$ 135 ~ $ 165
>=29 Roll
Meo Bio Energy Sales Co.LTD
LLUMAR Durable auto repaired coating oil proof film clear no yellowing heat repair car paint protection shatterproof
$ 850 ~ $ 860
>=1 Roll
Meo Bio Energy Sales Co.LTD
Hot selling TPU PPF glossy clear car stickers paint protection film scratch resistence for car surface protection
$ 390 ~ $ 400
>=1 Roll
Meo Bio Energy Sales Co.LTD
Chameleon TPU Materials Anti-yellow Self -healing 5 Years Warranty Car Paint Protective Film Clear Wrap Full Body Protection
$ 680 ~ $ 710
>=1 Roll
Meo Bio Energy Sales Co.LTD
TPU-V8 Easy Installment transparent car Body sticker self- healing film 1.52*15m
$ 390 ~ $ 420
>=1 Roll
Meo Bio Energy Sales Co.LTD
KDX ultra clear TPU paint surface protective film full car sticker car paint full protection
$ 34 ~ $ 37
>=23 square meter
Meo Bio Energy Sales Co.LTD
Vinyl Film for Car Clear Bra TPH Car Paint Protection
$ 78.5 ~ $ 157
>=10 Roll
Meo Bio Energy Sales Co.LTD
CARLAS Manufacturer Auto PPF Paint Protection Film Car Wrap Nano Film Car Vinyl Sticker Transparent Vinyl Film For Car
$ 120 ~ $ 130
>=2 Roll
Meo Bio Energy Sales Co.LTD
Self-Adhesive Clear Wrapping Car Paint Protection Tpu Film For Car
$ 10 ~ $ 60
>=30 Meter
Meo Bio Energy Sales Co.LTD
TPU Material PPF Self Healing Never Scratch Paint Protection Film
$ 360 ~ $ 380
>=1 Roll
Meo Bio Energy Sales Co.LTD
High Glossy Anti Scratch PPF Film Transparent Soft Self Adhesive TPU Car Wrapping Body Protection Film
$ 570 ~ $ 665
>=1 Roll
Meo Bio Energy Sales Co.LTD
SINOVINYL Super Pressure-sensitive Glue TPH Gloss Car Paint Protection Film PPF Wrap Vinyl
$ 240 ~ $ 300
>=1 Roll
Meo Bio Energy Sales Co.LTD
SINOVINYL TPH Super Transparent Clear Paint Protection Film For Car
$ 280 ~ $ 300
>=1 Roll
Meo Bio Energy Sales Co.LTD
Best seller window tint film PPF car paint protection film for car window protection
$ 200 ~ $ 240
>=5 Roll
Meo Bio Energy Sales Co.LTD
3 Layers Glossy TPH material film for car paint protection and Body Stickers Use tpu paint protection film
$ 135 ~ $ 145
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52*15m PVC PPF Anti Scratch Car Paint Protection Vinyl Wrap Film for Car
$ 60 ~ $ 75
>=1 Roll
Meo Bio Energy Sales Co.LTD
DOPONT USA quality clear nano ceramic TPU PPF paint protection film for body care
$ 465 ~ $ 525
>=2 Roll
Meo Bio Energy Sales Co.LTD
0.61*30m PPF With Coating Clear Anti Scratch Self-adhesive Self Healing Transparent ppf with coating Car Paint Protection Film
$ 300 ~ $ 360
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52M*15M Warranty 7~10Years Super Gloss Clear Heat-repaired Anti Scratch Car Wrapping Paint Protection Film TPU PPF
$ 570 ~ $ 665
>=1 Roll
Meo Bio Energy Sales Co.LTD
TPU Materia Super Transparent Clear Paint Protection Film For Car
$ 548 ~ $ 598
>=1 Roll
Meo Bio Energy Sales Co.LTD
DOPONT High Gloss Good Stain Penetration Resistant Car Full Body Paint Protection High Quality Clear Film Transparent TPU Film
$ 540 ~ $ 545
>=1 Roll
Meo Bio Energy Sales Co.LTD
Excellent Quality Auto Recovery Instant Self Healing Paint Protection Film Shield Ppf
$ 380 ~ $ 400
>=1 Roll
Meo Bio Energy Sales Co.LTD
3M PPF TPU for car custom size 1.52*15m car heat repairing transparent invisible wrap vinyl sticker film paint protection
$ 620 ~ $ 720
>=1 Roll
Meo Bio Energy Sales Co.LTD
1.52x15M 5x49FT Good Quality Super Stretchable Anti Scratch Heat Repair Gloss PPF TPU Clear Paint Car Body Protection Film Vinyl
$ 410 ~ $ 450
>=1 Roll
Meo Bio Energy Sales Co.LTD
Good quality self-repair clear roll ppf film paint protection
$ 486 ~ $ 550
>=2 Roll
Meo Bio Energy Sales Co.LTD
Korea ppf TPH transparent paint protection film with self healing
$ 580 ~ $ 640
>=1 Roll
Meo Bio Energy Sales Co.LTD
Factory wholesale TPH Anti-Scratch PPF Car Body Clear paint protection film
$ 280 ~ $ 320
>=1 Roll
Meo Bio Energy Sales Co.LTD
paint protection film korea paint protection film tpu ppf
$ 558 ~ $ 588
>=1 Roll
Meo Bio Energy Sales Co.LTD
CEO TPH transparent car paint protective film self adhesive film for car surface protection
$ 100 ~ $ 120
>=1 Roll
Meo Bio Energy Sales Co.LTD
Glossy and transparent TPU Paint Protection Film ppf for paint protection
$ 580 ~ $ 620
>=1 Roll
Meo Bio Energy Sales Co.LTD
Factory direclty sale good quality glossy clear TPU ppf film paint protection 6 mil self healing anti yellowing no residue
$ 298 ~ $ 316
>=6 Roll
Meo Bio Energy Sales Co.LTD
Factory Price Auto Repair Clear Paint Protection Film Tpu 152cmx15m Roll Self Healing Ppf Paint Protective Film For Suntek PPF
$ 642.8 ~ $ 785.7
>=1 Roll
Meo Bio Energy Sales Co.LTD
Good Quality TPH PPF Anti Scratch Protection Film Paint Protection Film For Car
$ 190 ~ $ 210
>=2 Roll
Meo Bio Energy Sales Co.LTD
SULAMEDER clear self healing car body stickers paint protection film tpu ppf film for automobile 1.52X15m
$ 395 ~ $ 400
>=1 Roll
Meo Bio Energy Sales Co.LTD
Related Searches:
xpelpaintprotectioncosttintedpaintprotectionfilmmattepaintprotectionfilmautopaintprotectionfilminstallersxpelstealthfilmclearcarhoodprotector3mpaintprotectionfilmamazoncarfilmcoating3mclearvinylprecutpaintprotectionfilmautoclearbra3mcarpaintprotectionfullcarppfcostcarstonechipprotectionclearfilmforcarsvehiclepaintprotectionfilmautomotiveprotectivefilmstonechipprotectionfilm3mantiscratchfilmforcarsclearmattewrapcarclearadhesivefilmforcarsxpelppffilmcostofppfwrapppfoncarcarmaskingfilmppfcarcoatingnearmecarclearbrainstallationnearmepaintchipprotection3mscotchgardpaintprotectionfilmproseriesclearbracarinstallationnearme