Welcome to TradeChina
-
Multi - color tobacco tobacco wire grinding cigarette equipment new cigarette machine accessories metal
$ 3.74 ~ $ 3.95
>=100 piec
Meo Food Co., Ltd.
IBC Automatic AdBlue Dispenser Filling Machine
$ 230.77 ~ $ 276.93
>=2 Set
Meo Textile Clothing Co.LTD
Hot Sale Automatic E-liquid Eye Drop Electric Ryo-mini-iii Cigarette Filling Machine Tobacco
$ -
>=1 Set
Meo Textile Clothing Co.LTD
JB-Y2 High quality 50ml 100ml full automatic electronic cigarette oil CBD oil filling capping machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
cigarette crushballs applicator crush ball dispenser cigarette bead machine
$ 1.7 ~ $ 2
>=100 boxe
Meo Food Co., Ltd.
YTK 5g-500g weighing and sub loading machine coffee powder grain seed quantitative dispensing filling machine price
$ 230 ~ $ 250
>=1 Set
Meo Textile Clothing Co.LTD
Menthol capsule balls Injector machine designed with cigarette lighters
$ 2.9 ~ $ 3.9
>=50 boxe
Meo Food Co., Ltd.
SINBON 50-1500kg Pallet Drum Filler Drum Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
YTK-W5000 Style 5000g Dry Food Powder Particle Dispenser/Filling Machine
$ 450 ~ $ 550
>=1 Set
Meo Textile Clothing Co.LTD
High Efficiency Automatic e-liquid Pod Filler E-Cigarette Liquid Cbd Hemp Oil Dispenser Vape Pen Cartridge Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
mineral water filler soda bottle vinegar water ice pop magnetic pump filling machine 10 L
$ 165 ~ $ 179
>=1 Set
Meo Textile Clothing Co.LTD
New Arrival Hot Sales High Quality semi-automated pneumatic filling machine alcohol
$ 400 ~ $ 450
>=1 Set
Meo Textile Clothing Co.LTD
KEFAI auto tabletop liquid filling and capping machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Liquid Dispensing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
999g Automatic Dispensing Machines Tea Coffee Powder Filling Machine
$ 314
>=1 Set
Meo Textile Clothing Co.LTD
Automatic dispensing machines
$ 830
>=1 Set
Meo Textile Clothing Co.LTD
Handheld portable semi auto automatic 510 hemp thick cbd oil vape pen injection cartridge filler gun filling machine 0.5 1ml
$ 140 ~ $ 145
>=5 piec
Meo Textile Clothing Co.LTD
New GFK 160 Digital Control Pump Semi Automatic Liquid Essential Oil Bottle Filling Machine
$ 45 ~ $ 60
>=1 Set
Meo Textile Clothing Co.LTD
1-100g weighting dispensing gas intelligent grain seed beans racking particle 100g tea coffee filling machine
$ 430 ~ $ 480
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic E Liquid Paint Water Cup Lip Balm Nail Polish Filling Machine
$ 870 ~ $ 950
>=1 Set
Meo Textile Clothing Co.LTD
GFK280 Smart Semi-automatic Desktop Digital Liquid FIlling Machine Fluid Dispenser
$ 110 ~ $ 130
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Herbal Medicine/Herbal Medicine Weighing Filling Machine/Tea Leaf Weighting Filling Production Line
$ 390 ~ $ 430
>=1 Set
Meo Textile Clothing Co.LTD
NEW ORIGINAL Handheld liquid filling machine
$ 50 ~ $ 57
>=1 piec
Meo Textile Clothing Co.LTD
ChaoXian Semi Automatic Gallon Drinking Drink Cup Washer Water Dispenser Filling Machine
$ 780 ~ $ 850
>=1 Set
Meo Textile Clothing Co.LTD
And Paste Cream Shampoo Bottle Bottling Juice Detergent Dispensing Liquid Borage Oil Filling Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Small Vffs Milk/Flour Powder Sachet Packing Machine with 25L Auger Filler
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Vertical Type Toothpaste Tubes Honey Hot Chili Tomato Sauce Jars Filling Machines Semi Automatic
$ -
>=1 Set
Meo Textile Clothing Co.LTD
automatic protein spice bag powder dispenser filling machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
desk type microcomputer intelligence black tea, green tea, Jasmine tea filling machine
$ 180 ~ $ 200
>=1 Set
Meo Textile Clothing Co.LTD
500ml full automatic mineral water bottle 4 nozzles filling machine liquid filling machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Outlet hemp Oil Dispensing e-Cigarette Cartridge Pen Vape Pod Juice Liquid filling machines automatic
$ -
>=1 Set
Meo Textile Clothing Co.LTD
YTK-SW100 Automatic Rotary Weighing Tea Food Dispenser Dispensing Machine And Filling Machinery For Seed Spice
$ 290 ~ $ 390
>=5 Set
Meo Textile Clothing Co.LTD
Full automatic nutella dispenser paste filling machine automatic filling machines with video
$ -
>=1 Set
Meo Textile Clothing Co.LTD
New arrival E-cigarette cbd oil dispenser machine XGX-ZY331 vape pen filling machine oil filler for sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
CE ISO Guangzhou spot Fast dispensing and stable performance fruit juice water filling machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CE ISO Fast dispensing and stable performance coffee capsule filling machine
$ 900
>=1 Set
Meo Textile Clothing Co.LTD
Crush Ball Applicator Cigarette Dispenser for Cigarette Crush Balls
$ 0.17 ~ $ 0.2
>=100 Gram
Meo Food Co., Ltd.
Stable performance and big volume semi automatic industrial coffee powder dispenser
$ -
>=1 Set
Meo Textile Clothing Co.LTD
CBD cartridge manufacturer Ocitytimes 510 cart filler robot filling dispensing robot
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic Desktop Disinfectant Sprays Alcohol Hand Sanitizer Gel Dispenser 2 Nozzles Dropper Bottle Liquid Filling Machine
$ 800 ~ $ 900
>=1 Set
Meo Textile Clothing Co.LTD
Menthol Capsules Ball Flavor Capsule For Cigarette
$ 0.37 ~ $ 0.55
>=580 Box(es)
Meo Food Co., Ltd.
Crushball dispenser cigarette pops beads
$ 0.37 ~ $ 0.98
>=100 Box(es)
Meo Food Co., Ltd.
Floor Type Liquid Single Double Head Oil Juice Bottle Filling Machine Pneumatic piston filling machine
$ 713 ~ $ 859
>=1 Carton(s)
Meo Textile Clothing Co.LTD
Automatic 1:1 Two Component Glue Dispensing Machine AB Glue Mixing Machine Epoxy Polyurethane Dispensing Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Semi Automatic E Liquid Bottle Vapor Cartridge Filling Machine Carts Filler For Silicone Cartridge
$ 135 ~ $ 140
>=5 piec
Meo Textile Clothing Co.LTD
KA PACKING factory Outlet Sauce/Honey Filling paste spout pouch dispensing machines
$ 850
>=2 Set
Meo Textile Clothing Co.LTD
semi-automatic liquid hummus bottle filling machine for tube liquid filling machine
$ 385 ~ $ 399
>=1 Set
Meo Textile Clothing Co.LTD
YTK-3000w 20-3000g distributor grain powder rice grain fertilizer filling machine
$ 540 ~ $ 560
>=1 Set
Meo Textile Clothing Co.LTD
China 1 Gallon PET Bottle Wax Candy Seman Spray Nail Gel Filling Machine With Stirring Tank
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pneumatic Thick Paste Honey Cosmetic Filling Machine
$ 630 ~ $ 650
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
laysvendingmachinesweetdispensermachinevendomachineforsalelocalvendingmachinecompaniestoycapsulemachinenestlecoffeevendingmachinenescafecoffeevendingmachinepriceteaandcoffeemachineforofficenorthwesternvendingmachinesautomaticcoffeevendingmachineexpendingmachineskittlesvendingmachineforsaleusedcombovendingmachinesquartercandymachinebestsellingvendingmachinecandypepsimachinesminipopmachinemechanicalvendingmachinehotvendingmachinesvendingmachineshopnewandusedvendingmachinescafecoffeedayvendingmachinepricevintagevendingrunningavendingmachinebusinessfooddispensermachineintelligentvendingmachinecoffeedaymachinecostvendingmachinesforsaleebayvendingstore1950scokemachine