Welcome to TradeChina
-
Professional And Safe Luxury Melamine Christmas Plates Serving Plate
$ 0.48
>=1000 piec
Meo Food Co., Ltd.
8 Inch Disposable Square Bagasse Plate,Biodegradable Tableware Plate White Salad Plates
$ 19.75 ~ $ 22.1
>=1 Carton(s)
Meo Food Co., Ltd.
White Eco Friendly Biodegradable Salad Plate Disposable Paper Plate
$ 0.02 ~ $ 0.03
>=1 Piece
Meo Food Co., Ltd.
100%biodegradable and compostable 3 compt round plates for cake salad fruit
$ 0.05
>=50000 piec
Meo Food Co., Ltd.
7inch to 14inch customize design melamine Merry Christmas dessert plate/melamine The giving plate/Plastic Salad plate
$ 0.88 ~ $ 1
>=3000 Set
Meo Food Co., Ltd.
Ceramic Indigo Salad Plates
$ 1.8 ~ $ 4.8
>=1200 Piece
Meo Food Co., Ltd.
Dessert Candy Dishes Bowl Ceramic Salad Tray Christmas Tree Bamboo Serving Plate
$ 3.98 ~ $ 6.98
>=54 Piece
Meo Food Co., Ltd.
4 Set Christmas Ceramic Salad Plate Handpainted Plates Food Dish Plate
$ 1.65 ~ $ 2.08
>=500 piec
Meo Food Co., Ltd.
8'' stamp crockery round stoneware Christmas salad dessert plate
$ 0.6 ~ $ 0.8
>=4000 Piece
Meo Food Co., Ltd.
eco friendly christmas plate set biodegradable salad plate retail packaging bagasse plates cutlery napkins cups customizable
$ 0.09 ~ $ 0.1
>=10000 Piece
Meo Food Co., Ltd.
Nordic table display animal design vegetable salad plate christmas plates ceramic cake dessert dish plate
$ 2 ~ $ 5
>=1000 Piece
Meo Food Co., Ltd.
Bamboo Wooden Ceramic Christmas Tree Snack Appetizer Dessert Serving Dishes
$ 1.6 ~ $ 6.8
>=500 Piece
Meo Food Co., Ltd.
Holiday Christmas Melamine square Joy Wooden pattern Design Salad Plastic Plates
$ 0.41 ~ $ 1.01
>=500 piec
Meo Food Co., Ltd.
Ceramic Salad Christmas Glaze Modern Dinner Set Japanese Grey Plates Restaurant Chaozhou Style Mexican Porcelain Round Plate
$ 1.32 ~ $ 1.47
>=100 piec
Meo Food Co., Ltd.
Customized Disposable 12" Craft Paper Salad Plate Christmas Truck Paper Plates for Kids Drawing
$ 0.07
>=800 Piece
Meo Food Co., Ltd.
Christmas tree pattern round melamine salad plates for indoor and outdoor
$ 0.36
>=3000 piec
Meo Food Co., Ltd.
Custom Halloween Party Melamine Plate Dinnerware Christmas Round Salad Dish Serving Plate Tableware for Restaurant Party
$ 0.36
>=3000 piec
Meo Food Co., Ltd.
Hand made decorative ceramic 3 cases christmas Salad/dessert plates 3 in 1 dish fruit plate
$ 2.2 ~ $ 3
>=1000 Piece
Meo Food Co., Ltd.
Solhui Cute hand-painted animal ceramics tableware fruit salad plate
$ 2.25 ~ $ 3.85
>=20 Piece
Meo Food Co., Ltd.
Salad/Dessert/Bread&Butter Plate with edge 8 inch Royal Fine Bone China tropical rain forest motif
$ 4
>=2 Box(es)
Meo Food Co., Ltd.
Christmas pottery painted cartoon rice bowl household noodle ramen salad bowl set plate dis Kitchen tray oven two-ear crockery
$ 1.5 ~ $ 4.2
>=48 Piece
Meo Food Co., Ltd.
best selling products Christmas Cookie Cutters Baking cup Wedding Dishes plates for wasabi seed ice tube, mixing salad bowl item
$ 0.25 ~ $ 0.3
>=500 Piece
Meo Food Co., Ltd.
Classic salad dessert melamine dinner plates custom logo OEM square cookie plastic christmas santa plate for restaurant home
$ 0.3 ~ $ 0.55
>=50 piec
Meo Food Co., Ltd.
9.5/11 inch red pink purple glazed A5 melamine heart shape plate
$ 1.38 ~ $ 1.73
>=500 piec
Meo Food Co., Ltd.
Household ceramic tableware handpainted creative "LOVE" plate snacks & candy plate fruit salad plate
$ 1.68 ~ $ 1.75
>=20 piec
Meo Food Co., Ltd.
eco friendly set of 2 Palm Leaves bamboo fiber salad plates assorted
$ 0.6 ~ $ 0.75
>=1000 piec
Meo Food Co., Ltd.
100% Biodegradable disposable white bagasse sugarcane plates for BBQ
$ 0.04 ~ $ 0.06
>=30000 piec
Meo Food Co., Ltd.
Wholesale fashion ceramic reusable christmas taco plates salad plate dishes
$ 1.5 ~ $ 3.5
>=500 Piece
Meo Food Co., Ltd.
8 Inch 10 inch Fancy Gold Ring Ceramic Dinner Plate Salad Dishes Tableware Set Kitchen Dinnerware Black White
$ 2.3 ~ $ 3.6
>=48 Piece
Meo Food Co., Ltd.
100% Biodegradable Bamboo Sugarcane Bagasse Pulp Lunch Box Salad Soup Bowl Disposable Paper Tableware Dinnerware Sets With Lid
$ 0.03 ~ $ 0.04
>=15000 piec
Meo Food Co., Ltd.
Disposables Plastic Food Plates Square Plastic Plates for Weddings and Parties
$ 9.32 ~ $ 9.76
>=300 Box(es)
Meo Food Co., Ltd.
8 10 inch Fancy Gold Ring Ceramic Dinner Salad Plate Dishes Tableware Set Kitchen Dinnerware Black White
$ 3.1 ~ $ 3.8
>=24 Piece
Meo Food Co., Ltd.
Custom 201 Stainless Steel Salad Food Plate Dinner Plate Dishes
$ 4
>=4000 piec
Meo Food Co., Ltd.
Black Porcelain Plate China Table Ware 2021 New Design Gold Line Restaurant Ceramic Dinner Plates Round Plates Ceramic Tableware
$ 3.55 ~ $ 4.44
>=100 Piece
Meo Food Co., Ltd.
6/8/10/12 inch European Nordic Porcelain Plates Sets Dinnerware Ceramics Bread Salad Serving Dinner Charger Plates for Weddings
$ 0.89 ~ $ 3.18
>=300 Piece
Meo Food Co., Ltd.
6 Compartments Flower Shape Bamboo Fruit Platter,Snack Plate For Dessert Or Salad In Christmas
$ 6.5 ~ $ 6.99
>=500 Set
Meo Food Co., Ltd.
Wheat straw BPA free plastic food dish plate microwave safe salad cake dishes unbreakable dinner plates
$ 0.13 ~ $ 0.49
>=20 Piece
Meo Food Co., Ltd.
P&T Porcelain Black Round Salad Plate Gold Rim Ceramic Soup Plate, Direct Factory Deep Plate For Restaurant
$ 7.52 ~ $ 8.72
>=500 piec
Meo Food Co., Ltd.
Wholesale 100% Melamine Dinner Plates 10" Diameter Rustic Crackle Light Blue
$ 2.01 ~ $ 2.98
>=24 Piece
Meo Food Co., Ltd.
custom golden rim food cake tea charger salad dessert porcelain ceramic marble surface round big small dinning dinner plates set
$ 0.8 ~ $ 4
>=1 Piece
Meo Food Co., Ltd.
High Quality Acacia Wood Round Wooden Plates Serving Tray Cake Dishes Kitchen Tableware Plate For Dessert Salad Fruit
$ 5.38 ~ $ 6.68
>=100 Piece
Meo Food Co., Ltd.
Nordic Pink Set Dinner Plate Custom Soup Bowls Takeaway Ceramic Salad Dishes Decal Pasta Soup Bowl Plates
$ 0.58 ~ $ 0.68
>=5000 Set
Meo Food Co., Ltd.
Logo Decal Personalized Ceramic Porcelain Salad Dessert Soup Plates For Hotel And Restaurant
$ 2.2 ~ $ 2.27
>=50 piec
Meo Food Co., Ltd.
Western Dinnerware Set Creative Phnom Penh Hammered Gold Plated Fruit Salad Bowl for Boho Wedding Restaurant Glass Dishes Plates
$ 2.5 ~ $ 4.35
>=2 Piece
Meo Food Co., Ltd.
Nordic simple design ceramic colored clay salad bowl fruit bowl rice bowl with reactive glaze for houseware
$ 2
>=2 Piece
Meo Food Co., Ltd.
European and American-Style Hand-Painted Ceramic Creative Irregular Western Dish Salad Plate Home Charger Plate Dish
$ 4.5 ~ $ 4.9
>=100 Piece
Meo Food Co., Ltd.
New modern style marble ceramic plates for sushi and steak
$ 0.74 ~ $ 1.48
>=20 Piece
Meo Food Co., Ltd.
New Nordic creative matte ceramic fruit salad tableware noodle French sea bowl with wooden frame
$ 3.4 ~ $ 4.6
>=48 piec
Meo Food Co., Ltd.
Nordic Hand Painted Irregular Porcelain Dinner Tableware Sushi Salad Plate Dish Dinnerware Set Ceramic Plate
$ 3.98 ~ $ 6.46
>=36 Set
Meo Food Co., Ltd.
Restaurant dinnerware green round salad steak pasta plate ceramic charger plates for dinner
$ 3.37 ~ $ 4.88
>=48 Piece
Meo Food Co., Ltd.
Related Searches:
beautifuldinnerplatescorelledinnerplateswalmartovensafedinnerplateskidsceramicplatesusedrestaurantplatesblackceramicdinnerplatesglassdeviledeggplattertargetplatesandbowlsnavydinnerplatesdenbybluedishescorelleappetizerplatessquarediningplatesheartdinnerplatesdeepdinnerplatesvintageglassdeviledeggplateantiquedeviledeggplatesauceservingdishsunflowerdinnerplatesstonewaresaladplateschurchillbluewillowdisheswhitedisheswalmartlargeservingplateblueandwhitemelamineplatessmallservingplatesredandwhitedinnerplateswhitechinadinnerwarevilleroy&bochdinnerplatesindividualdinnerplatesblueenamelplatesredglassdinnerplates